(data stored in ACNUC7421 zone)

EMBL: CP000438.PE569

CP000438.PE569       Location/Qualifiers
FT   CDS_pept        622492..622692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLP1"
FT                   /protein_id="ABJ15516.1"
FT                   /translation="MRSVTLPLLMFCLGLAACSGDGGRRPSTCEVISPPDVMVPTEQNR
FT                   QRVEQQSSGDPTAGQKPVECP"
     atgcgttccg taaccttgcc actcctgatg ttctgcctgg gcctggccgc ctgtagcggc        60
     gatggcggtc gacgcccgag cacctgcgag gtgatcagtc cgccggacgt gatggtgccg       120
     accgagcaga accgccagcg ggtcgagcag cagagtagcg gcgatccgac cgccggacaa       180
     aagccggtgg aatgcccgta g                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page