(data stored in ACNUC7421 zone)

EMBL: CP000438.PE570

CP000438.PE570       Location/Qualifiers
FT   CDS_pept        622852..623193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07210"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15517"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKU2"
FT                   /protein_id="ABJ15517.1"
FT                   /translation="MNYSRIALLGGLAAAALLAGCSGSSGKPGGKDWTRWTCDSKAVIE
FT                   WRYIDGSKNIVDLRLKDEDDVVHHLEQEPAAVGAFYSDGRLGFHLENDEGLVYWVETDD
FT                   LIGRGCKAR"
     atgaactact cgcgtatcgc cctgctcggc ggcctcgccg ccgcggccct gctggccggc        60
     tgctccggct cctcgggcaa gcccggtggc aaggactgga cccgctggac ctgcgacagc       120
     aaggcggtga tcgaatggcg ctatatcgac ggcagcaaga acatcgtcga cctgcgcctg       180
     aaggacgagg acgacgtggt ccaccatctg gagcaggaac ctgcggccgt cggcgctttc       240
     tatagcgacg gacgcctggg cttccacctg gagaacgacg aaggcctggt gtactgggtc       300
     gaaaccgacg acctcatcgg tcgcggttgc aaggcgcgct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page