(data stored in ACNUC7421 zone)

EMBL: CP000438.PE572

CP000438.PE572       Location/Qualifiers
FT   CDS_pept        624443..624925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07240"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH2"
FT                   /protein_id="ABJ15519.1"
FT                   /translation="MRRWLLTLPFLLLAGCAGLHAPSRDVEEAASPSVARDPADPQDCL
FT                   ARSDCTTKTSRTLLFVFDYAEAGGELVVRDGRRLETPPAPQRSTWPALRIQLAEPVNGR
FT                   FEFESPCLRKSGKGCRYSQATLLKVYRSYLVGKPCSLLSPRAVKRCVDPATTAARR"
     atgcgccgct ggctcctgac cctgccgttc ctcctgctgg ccggttgcgc tggcctgcac        60
     gcgccgtccc gcgacgtcga ggaggccgcg tcgccgagcg tagcgcgtga tcccgccgat       120
     ccgcaggatt gcctggcgcg tagcgactgc acgaccaaga cttcgcgcac cctgctgttc       180
     gtcttcgact atgcagaggc cggcggcgaa ctggtggtgc gcgacggtcg ccgactggaa       240
     accccgccgg cgccgcaacg ctccacctgg ccggcgttgc gcatccagct ggccgagccg       300
     gtcaacggtc gcttcgagtt cgagagcccc tgcctgcgca agagcggcaa gggctgccgc       360
     tacagccagg ctacgctgct gaaggtctac cgcagctacc tggtcggcaa gccttgctcg       420
     ctgctcagcc ctcgcgcagt gaaacgctgc gtcgacccgg cgacgaccgc cgcgcggcgc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page