(data stored in ACNUC7421 zone)

EMBL: CP000438.PE574

CP000438.PE574       Location/Qualifiers
FT   CDS_pept        625582..626349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07260"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15520"
FT                   /db_xref="GOA:A0A0H2ZL84"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL84"
FT                   /protein_id="ABJ15520.1"
FT                   /translation="MSSVHSAAQQGFSAEAQRYAQGRPEYPEALSDWLRDALGLRPQTV
FT                   AVDLGAGTGKFTRLLARTGARVVAVEPVDAMRAQLAEALPQVQALAGSAQSIPLANGFA
FT                   DALVCAQAFHWFATVEALEEMRRVLTAEGRLGLVWNVRDESLDWVAEITRIITPYEGDA
FT                   PRFYKGDWRRPFERAPFGPLRLSTFAYEHVGPPEQVIVSRFLSVSFIAALPETEKNAVA
FT                   AQLRELVASHPALKGKEQVALPYRTEAYLAEAR"
     atgtcgtccg tacacagcgc cgcccagcaa ggtttcagcg ccgaggccca gcgttacgcc        60
     cagggccggc ccgagtatcc ggaagcgctc tccgactggt tgcgcgatgc ccttggcctg       120
     cgtccgcaga ccgtcgcggt ggacctcggc gccggcaccg gcaagttcac ccgcctgctg       180
     gcccgtaccg gcgcgcgggt ggtcgcggtg gaaccggtgg atgcgatgcg cgcgcagctc       240
     gccgaagcct tgccgcaggt ccaggcgctg gccggtagcg cccagtcgat tccgttggcc       300
     aacggcttcg ccgacgccct ggtgtgcgca caggccttcc attggttcgc caccgtggag       360
     gcgctggagg aaatgcgccg cgtgctgacg gcggaaggca ggctggggct ggtgtggaac       420
     gtgcgtgacg agtcgctgga ttgggtcgcc gagatcaccc gcatcatcac cccctacgaa       480
     ggcgatgcgc cgcgtttcta caagggcgac tggcgtcggc cgttcgagcg tgcgcccttc       540
     ggaccgctgc gactttccac cttcgcctac gagcatgtcg gcccgccgga gcaggtgatc       600
     gtctcgcgct tcctttcggt gagcttcatc gccgccttgc cggagacgga aaagaacgct       660
     gtggcggcgc aattgcgcga gctggtcgcc agccacccgg cgctcaaggg gaaggagcag       720
     gtagcgctgc cctatcgcac cgaggcctat ctggccgagg cgcgctag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page