(data stored in ACNUC7421 zone)

EMBL: CP000438.PE577

CP000438.PE577       Location/Qualifiers
FT   CDS_pept        628151..629305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07300"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15524"
FT                   /db_xref="GOA:A0A0H2ZLH9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH9"
FT                   /protein_id="ABJ15524.1"
FT                   /translation="MGSASQRSVQDLYEDVGDHYRIFIRAPFFQLLKHRDYWVPLLYFF
FT                   FVLITMFWDLYCHSGQYLYEARSLLPFYLFPFLIAALRIGDIVVDTRCRNVENLGGFER
FT                   SAESSRYVQLSLYERQWFRLRYRAYGGNLRCLAGDLVENWRLWKEVNSKAAKDIDGAVM
FT                   LRFFLPPRDLARLVTLLAALIAVIATLIITLGADRQGYFEFVDNLPAYLKLYWGVVFII
FT                   AFSGPYMIFLGMQARLVLRAMIDALSISQPSDKLFYQFIQRLIWADGVKPANPSANSRV
FT                   LRAVDSMVDFFYEEWRSAIGKLVLWLVALLVLLLCTLLHCLLRVFSSARTLGEALMRIL
FT                   LAVLGGVCWIVAAIQRLNLAVPFHWTFFVLTGTGALFATLCGQP"
     atgggaagcg cttcgcaacg ttcggtgcag gatctttatg aggacgtggg agatcactac        60
     cggatcttta tccgggcgcc attctttcaa ttgctgaaac acagggacta ctgggttccc       120
     ctgctgtatt tcttcttcgt gttgatcacg atgttctggg acttgtattg ccactccgga       180
     cagtacctct acgaagccag gagtctgctc cctttctatc tgttcccgtt tctgatcgct       240
     gcgctacgga taggcgatat cgtcgtcgat acgcgctgtc gcaatgtgga gaacctggga       300
     ggcttcgagc gctccgccga gagcagtcgc tacgtccagc tttccctcta cgaacggcaa       360
     tggttccggc tgcggtaccg ggcctatggc ggtaacctcc gctgcctggc gggcgatctg       420
     gtggagaact ggcgcctctg gaaggaggtg aattcgaagg ccgcgaagga tatcgacggc       480
     gcagtgatgc tgcgattctt tctgcctccc cgggaccttg ctcgtctggt cacgctgttg       540
     gctgcgctca ttgcggtcat cgccactctc atcattaccc tgggggctga caggcagggc       600
     tatttcgagt ttgtcgacaa cctgcccgcc tatctgaaac tgtattgggg cgtcgttttc       660
     atcattgcct tcagcggtcc atacatgatc ttcctgggga tgcaggcgcg cctggtactg       720
     cgcgcaatga tcgacgcatt gtccatttcc caaccaagcg acaagctgtt ctatcaattc       780
     atccagcggc tcatctgggc ggacggagtg aaaccggcga accccagtgc caacagcagg       840
     gtgctacggg cggtcgactc catggtcgac ttcttctacg aggagtggag aagcgccatc       900
     ggcaagcttg tgctgtggct cgttgccctg cttgtgctgc ttctttgcac gcttttgcat       960
     tgcctgctcc gagtcttttc ctcggcgaga acgttgggag aggcgctgat gcggattctc      1020
     ttggctgttc tggggggcgt ttgctggata gtcgcggcga tccagcgctt gaatcttgcc      1080
     gtgcccttcc actggacctt cttcgtgctg acgggaacgg gagccttgtt cgcaaccctc      1140
     tgcgggcagc cctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page