(data stored in ACNUC7421 zone)

EMBL: CP000438.PE579

CP000438.PE579       Location/Qualifiers
FT   CDS_pept        complement(630110..630463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15526"
FT                   /db_xref="GOA:A0A0H2ZLQ2"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLQ2"
FT                   /protein_id="ABJ15526.1"
FT                   /translation="MEWFLKCVKEHYFDFNGRARRKEYWMFTLVNIIISVALSVVLGLI
FT                   SEKLLPIANLYSLAVLLPALGVTARRLHDINKSGWWMLIALIPIVGLYLIYLLAKDSDA
FT                   GQNQYGQNPKGIA"
     atggaatggt ttctgaaatg cgtgaaggaa cactacttcg acttcaacgg gcgtgcccgt        60
     cgcaaggaat actggatgtt caccctggtg aacatcatca tctccgtcgc gctgagcgtc       120
     gtgctcggcc tgatcagtga aaagctcctg ccgatcgcca atctctactc gctcgccgtg       180
     ctgctgccgg ccctgggcgt caccgcccgg cgtctgcacg acatcaacaa gagcggctgg       240
     tggatgctga tcgcgctgat cccgatcgtc ggcctgtacc tgatctacct gctggccaag       300
     gacagcgacg ccggccagaa ccagtacggc cagaacccga aaggcatcgc ctga             354
//

If you have problems or comments...

PBIL Back to PBIL home page