(data stored in ACNUC7421 zone)

EMBL: CP000438.PE581

CP000438.PE581       Location/Qualifiers
FT   CDS_pept        631670..632008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07355"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15643"
FT                   /db_xref="GOA:A0A0H2ZLH8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLH8"
FT                   /protein_id="ABJ15643.1"
FT                   /translation="MLNNWTEFVPAVKKAFGALGKQHPKMLAAYGALEEASAEGALDAK
FT                   TRELISIAVAITTRCDGCIGVHTEAALKAGASEAEIAQTLATAISLNAGAAYVYSLRAL
FT                   EAYDQFKK"
     atgctgaaca actggaccga gttcgtcccc gccgtgaaaa aagccttcgg tgccctgggc        60
     aagcaacacc cgaagatgct cgccgcctat ggcgcgctgg aggaagccag tgccgagggc       120
     gccctggatg ccaagacccg cgaactgatc tccatcgccg tggctattac cacccgttgc       180
     gacggttgca tcggcgtgca caccgaggcc gcgctgaagg ccggcgccag cgaggcggaa       240
     atcgcccaga ccctggctac cgccatctcc ctgaatgccg gcgccgccta tgtctattcg       300
     ctgcgcgcgc tggaagccta cgaccagttc aaaaagtga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page