(data stored in ACNUC7421 zone)

EMBL: CP000438.PE582

CP000438.PE582       Location/Qualifiers
FT   CDS_pept        complement(631998..632513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07360"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15528"
FT                   /db_xref="GOA:A0A0H2ZKI0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI0"
FT                   /protein_id="ABJ15528.1"
FT                   /translation="MSDLPPRPAFWPYLPGYALLLLSVLLCASGSYRFVTPMALADGVD
FT                   LVYLSQGLALLPLGTGLVGLLAGFLLHVRGRWLGALLALLPATLICAWNLYNYAAHGDE
FT                   ALSPSFAQYTQALLGLLLLGGVLSLVDLLHGRPSTLLRKGLLGLGWLALVAWLGLLFYL
FT                   QRLYGLTF"
     atgtccgacc tgcccccgcg tcccgccttc tggccgtacc tgccgggcta cgccctgttg        60
     ctgctttcgg tgctgctctg cgccagcggc agctaccgtt tcgtcacccc gatggcgctc       120
     gccgacggcg tcgacctggt ctacctcagc cagggcctgg cgctgctacc gctgggtacc       180
     gggctggtcg gcctgctcgc gggcttcctc ctgcatgtcc gcgggcgctg gctcggcgcg       240
     ctgctggcgc tgctgccggc gacgctgatc tgcgcctgga acctgtacaa ctatgccgcc       300
     cacggcgacg aggcgttgtc gccgagtttc gcccagtaca cccaggcgct gctcggcctg       360
     ctgctgctcg gcggcgtgct gagcctggtc gacctgctcc acggcaggcc ctcgacgctg       420
     ctgcgcaagg gcctgctggg gctgggctgg ctggccctgg tggcctggct ggggttgctg       480
     ttctacctgc agcgcctgta cggcctcact ttttga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page