(data stored in ACNUC7421 zone)

EMBL: CP000438.PE584

CP000438.PE584       Location/Qualifiers
FT   CDS_pept        complement(632869..633327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07380"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15530"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL94"
FT                   /protein_id="ABJ15530.1"
FT                   /translation="MELIRNLDDANMGEVYWRLYRRYISLFIENEADDAYAWRCARALD
FT                   ELDDAVVERLCAASLRYRAARLERLGESAEEVAPARGVLERIEPGELIVPDPEQGDEAV
FT                   IHLSLNCEWDREHGMEWIVRGGEVLYVGPFHGEDPWRDFTVKEPWNYA"
     atggaactga tccgcaacct ggacgatgcg aacatgggcg aagtgtattg gcgcctgtac        60
     cggcgctaca tcagcctgtt catcgagaac gaggccgacg acgcctacgc ctggcgctgc       120
     gcccgagccc tcgacgaact ggatgacgcc gtggtcgagc ggctttgtgc cgccagcctg       180
     cgctaccgcg ccgcgcgcct ggagcggctg ggcgagtctg cggaggaagt cgcgccggcg       240
     cgcggggtgc tggaacggat cgaaccgggc gagctgatcg tgcccgaccc ggaacagggc       300
     gacgaagcgg tgatccacct gtcgctgaac tgcgaatggg accgcgaaca cggtatggaa       360
     tggatcgtcc ggggcggcga ggtgctctat gtcggcccct tccacggcga agacccgtgg       420
     cgggacttca ccgtgaagga accatggaac tacgcctga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page