(data stored in ACNUC7421 zone)

EMBL: CP000438.PE585

CP000438.PE585       Location/Qualifiers
FT   CDS_pept        complement(633343..633813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07400"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15531"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLQ7"
FT                   /protein_id="ABJ15531.1"
FT                   /translation="MIPFGLSTEQFRERYRRDLQRAAPGVIQHLRELLRQPLEEGLRDG
FT                   EIQLFLGEDGRDAAEAWLYLNGASNRVDASDPRLFPGKTLDLALGLGHAPDFDEAYFAD
FT                   GFGGVDLLADTLQAWFAECWWKAGGWAWPIPLWLHVHDGFGDGRGIALTERC"
     atgattcctt tcggcctcag caccgaacaa ttccgcgagc gctaccgccg cgacctgcaa        60
     cgcgccgcgc cgggcgtgat ccagcacctg cgcgagctgc tccggcaacc cttggaggaa       120
     ggactgcgcg acggcgagat ccaactgttc ctcggcgagg acggacgcga cgcagcggaa       180
     gcgtggttgt acctgaatgg cgccagcaac cgggtggacg ccagcgaccc gcgcctgttt       240
     cccggcaaga cgctggacct ggcgctcggc ctgggacatg ccccggattt cgacgaagcc       300
     tatttcgccg acggcttcgg cggcgtcgat ctgctcgccg atacgctgca agcctggttc       360
     gccgagtgct ggtggaaggc cggcggctgg gcctggccga tcccgctgtg gctgcacgta       420
     cacgatggct tcggcgacgg ccgtggcatc gccctcaccg aacgctgctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page