(data stored in ACNUC7421 zone)

EMBL: CP000438.PE586

CP000438.PE586       Location/Qualifiers
FT   CDS_pept        complement(633827..634174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15532"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKV9"
FT                   /protein_id="ABJ15532.1"
FT                   /translation="MKPELDALEAWLGQPLPAAFVAALEQHGGRLVEPGLLLYAADELL
FT                   ERNRAFETSLYCPGYLAIGDDSGGRAVVMALDDHRQALFLVDHGAMTPDCFEPLAPSLE
FT                   AWLEAGPCLPE"
     atgaagcctg aattggatgc cctagaggcc tggctcggac aaccgctgcc ggctgccttc        60
     gtcgccgctc tggagcagca cggcggccgc ctcgtcgagc cgggcctgct gctctacgcc       120
     gccgacgagt tgctggaacg caaccgggcc ttcgaaacct ctctctactg ccccggctac       180
     ctggccatag gcgacgacag cggcggccgc gccgtggtga tggccctgga cgatcaccgg       240
     caggcgctgt tcctggtcga ccatggcgcg atgaccccgg actgcttcga acccctggca       300
     cccagcctgg aggcctggct ggaagccggg ccctgcctgc ccgaatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page