(data stored in ACNUC7421 zone)

EMBL: CP000438.PE587

CP000438.PE587       Location/Qualifiers
FT   CDS_pept        complement(634164..634778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07420"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15533"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKI3"
FT                   /protein_id="ABJ15533.1"
FT                   /translation="MTDRLPCRACGHLILPTTAARNDGLCMPCKGGYRQNIEDGKRFHT
FT                   ERRRYLASPQALYWSALVSRVYDGREGFAGLSPAERSYYAVSVLSGEVHNGGFDQYFGN
FT                   SSGDQYQAARAGLRELEAEDALALLERAAALLFGDAPVPVSQAERQLRMPTWADQPDRD
FT                   CEAALNALDTRFYALADALGERLLAHARHHALFALDEPDEA"
     atgaccgacc gccttccctg ccgcgcctgc ggccatctca ttctcccgac cacggcggcg        60
     aggaacgacg gactgtgcat gccctgcaag ggcggctacc ggcagaacat cgaggatggc       120
     aagcgtttcc acacggagcg acggcgctac ctggcgagtc cgcaggcgct gtactggagc       180
     gcgctggtga gtcgcgtcta cgatggccgc gagggattcg ccgggctgtc gccggccgag       240
     cggagctact acgcagtgag cgtgctcagc ggcgaagtgc acaacggcgg cttcgaccag       300
     tacttcggca actcctccgg cgaccagtac caggcggcgc gcgcgggtct tcgcgaattg       360
     gaggcggagg acgccctggc cctgctggag cgagccgccg ccctgctgtt cggcgacgct       420
     ccggtgccag tctcccaggc cgaacgccag ttgcgcatgc cgacctgggc cgatcaaccc       480
     gaccgcgact gcgaagcggc cctgaatgcg ctggacacgc gcttctacgc cctggccgac       540
     gcgctgggcg aacgcctgct ggcccatgcc cgccaccatg cattgttcgc cctggacgag       600
     cccgatgaag cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page