(data stored in ACNUC7421 zone)

EMBL: CP000438.PE588

CP000438.PE588       Location/Qualifiers
FT   CDS_pept        complement(634969..637740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07430"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15534"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR040711"
FT                   /db_xref="InterPro:IPR041549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ2"
FT                   /protein_id="ABJ15534.1"
FT                   /translation="MSLSTTAFPSLQGENMSRSPIPRHRALLAGFCLAGALSAQAATQE
FT                   EILDAALVSGDSSQLTDSHLVALRLQQQVERIRQTRTQLLDGLYQNLSQAYDPGAASMW
FT                   VLPANPDNTLPFLIGDKGRVLASLSLEAGGRGLAYGTNVLTQLSGANAAHAPLLKRAVQ
FT                   WLVNGDPGAATAKDFKVSVVGVDKTATLNGLKSAGLQPADAACNALTDASCASTSKLLV
FT                   LGNGASAASLSATVRARLQAGLPILFVHTNGWNQSSTGQQILAGLGLQEGPYGGNYWDK
FT                   DTVPSSRTRTRSVELGGAYGQDPALVQQIVDGSWRTDYDWSKCTSYVGRTTCDDVPGLS
FT                   DFSKRVDVLKGALDAYNQKAQNLFALPGTTSLRLWLLWADAVRQNIRYPMDKAADTARF
FT                   QETFVADAIVGYVREAGAAQKELGSYAGQRQQSMPVSGSEETLTLTLPSAQGFTAIGRM
FT                   AAPGKRLSIRIEDAGQASLAVGLNTQRIGSTRLWNTRQYDRPRFLKSPDIKLQANQSVA
FT                   LVSPYGGLLQLVYSGATPGQTVTVKVTGAASQPFLDIQPGEDSSQAIADFIQALDADKA
FT                   DWLEIRSGSVEVHAKVEKVRGSIDKDYGGDVQRFIRELNEVFIDDAYTLAGFAIPNQAK
FT                   TPAIQQECAVRGWDCDSETLHKLPGTQHINVDQYAQCGGGCSGNPYDQTWGLNPRGWGE
FT                   SHELGHNLQVNRLKVYGGRSGEISNQIFPLHKDWRVLREFGQNLDDTRVNYRNAYNLIV
FT                   AGRAEADPLAGVYKRLWEDPGTYALNGERMAFYTQWVHYWADLKNDPLQGWDIWTLLYL
FT                   HQRQVDKSDWDASKAALGYGTYAQRPGNSGDASSTDGNDNLLLGLSWLTQRDQRPTFAL
FT                   WGIRTSAAAQAQVAAYSFAEQPAFFYANNRTNEYSTVKLLDMSQGSPTWPFP"
     gtgagcttgt ccaccactgc atttccctca ctgcaaggag agaacatgag tcgctcaccc        60
     atccctcgcc accgagcgtt gctggccggt ttctgcctgg ctggcgcgct gtccgcccag       120
     gcggccaccc aggaagaaat cctcgatgcg gcactggtca gcggggattc ctcgcaactg       180
     accgacagcc acctggtcgc cctccgcctg cagcagcagg tcgagcgcat ccgccagacc       240
     cgcacgcagt tgctcgacgg tctctaccag aacctcagcc aagcctatga tcctggcgcc       300
     gccagcatgt gggtcctgcc ggccaacccg gacaataccc tgcccttcct catcggcgac       360
     aaggggcgcg tgctcgccag cctgagcctg gaggccggcg gccgcgggct ggcctatggc       420
     accaacgtgc tcacccaact gagcggggcc aatgccgccc acgcgccgct gctgaagcgg       480
     gcggtgcagt ggctggtgaa cggcgacccg ggcgcggcca ctgcgaagga cttcaaggtc       540
     agcgtggtcg gggtggacaa gaccgccacc ctcaacggcc tgaagagcgc cggcctgcaa       600
     ccggcggacg ccgcctgcaa cgcgctgacc gacgccagtt gcgccagcac cagcaaattg       660
     ctggtactgg gcaacggcgc cagcgccgct agcctgagcg ccacggtgcg cgcacggcta       720
     caggccgggc tgccgatcct cttcgtgcac accaatggct ggaaccagag cagcaccggc       780
     cagcagatcc tcgccggcct gggcctgcag gaaggcccct acggcggcaa ctactgggac       840
     aaggacacgg tgccatccag ccgcacccgg acgcgttcgg tcgagttggg cggcgcctat       900
     ggccaggacc cggcgctggt gcagcagatc gtcgacggta gctggcgcac ggactacgac       960
     tggtcgaaat gcacctccta cgtcggtcgc accacctgcg acgacgtgcc gggactgagc      1020
     gacttcagca agcgcgtcga tgtattgaaa ggcgccctcg acgcctacaa ccagaaggcg      1080
     cagaacctct tcgccctgcc cggcaccacc tcgctgcggc tctggctgct gtgggccgac      1140
     gcggtgcggc agaacatccg ctacccgatg gacaaggccg ccgacacggc gcgcttccag      1200
     gaaaccttcg tcgccgacgc catcgtcggc tacgtgcgcg aggccggcgc ggcgcagaag      1260
     gaactgggca gctacgccgg ccagcgccaa cagtcgatgc cggtatcggg ctcggaggaa      1320
     accctgaccc tcaccttgcc gtcggcccag ggcttcaccg ccatcggccg catggcggcg      1380
     ccgggcaagc gcctgagcat ccgcatcgaa gacgctggcc aggccagcct ggcggtcggc      1440
     ctgaacaccc agcgcatcgg ctcgacgcgg ctgtggaata cccgccagta tgaccgcccg      1500
     cgcttcctca agagcccgga catcaagctc caggcaaacc agtcggtggc gctggtatcg      1560
     ccctacggcg gcctgttgca actggtctac agcggcgcca cgccgggtca gacggtaacc      1620
     gtcaaggtaa ccggcgcggc cagccagccg ttcctcgaca tccagccggg cgaggacagc      1680
     agccaggcga ttgccgactt catccaggcg ctggacgccg acaaggccga ctggctggag      1740
     atccgcagcg gctcggtgga ggtccacgcc aaggtggaga aggtccgtgg ctcgatcgac      1800
     aaggactatg gcggcgacgt ccagcgcttc atccgtgagt tgaacgaggt gttcatcgac      1860
     gacgcctaca ccctggccgg cttcgccatt cccaaccagg cgaagactcc ggcaatccag      1920
     caggaatgcg cggtgcgcgg ctgggactgc gacagcgaga ccctgcacaa gctgcccggc      1980
     acccagcaca tcaacgtcga ccagtacgcc cagtgcggcg gcggttgcag cggcaacccc      2040
     tacgaccaga cctggggcct gaacccgcgt ggctggggcg aaagccatga gctgggccac      2100
     aacctgcaag tgaatcgact gaaggtctac ggcgggcgct cgggcgaaat ctccaaccag      2160
     atattcccgt tgcacaagga ctggcgcgtg ctccgcgagt tcgggcagaa cctcgacgat      2220
     acgcgggtca actaccgcaa cgcctacaac ctgatcgtcg ccgggcgcgc cgaggccgat      2280
     ccgctggcag gcgtatacaa gcgcctgtgg gaagacccgg gcacctacgc gctgaacggc      2340
     gagcgaatgg ccttctatac ccagtgggtg cactactggg ccgacctgaa gaacgatccg      2400
     ctgcagggtt gggatatctg gaccctgctc tacctgcacc agcgccaggt ggacaagtcc      2460
     gactgggacg ccagcaaggc cgctctcggc tacggcacct acgcccagcg cccgggaaac      2520
     agcggcgatg ccagcagcac ggacggcaac gacaacctgt tgctcggcct gtcctggctg      2580
     acccagcgcg accagcggcc aaccttcgcg ctatggggca tccgtacctc ggcagcggcc      2640
     caggcgcagg tggcggccta cagtttcgcc gagcagccgg cgttcttcta tgccaacaac      2700
     cggaccaacg aatacagcac ggtgaagctt ctggacatga gccaggggtc gccgacgtgg      2760
     ccgtttccgt ga                                                          2772
//

If you have problems or comments...

PBIL Back to PBIL home page