(data stored in ACNUC7421 zone)

EMBL: CP000438.PE589

CP000438.PE589       Location/Qualifiers
FT   CDS_pept        complement(638309..638644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07440"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15535"
FT                   /db_xref="GOA:A0A0H2ZL99"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL99"
FT                   /protein_id="ABJ15535.1"
FT                   /translation="MDYSPIVAQVWGMLTWFIPAALLIGLLKSPWAKGQIGELLVRLFA
FT                   HWQLDRQTYRRLHNVTLNTPDGTTQIDHVFFSPYGIFVLETAGFQHLPIGLYRCTGEPC
FT                   CRSQALA"
     gtggattaca gcccgatagt cgcccaggtc tggggcatgc tgacctggtt tatcccggca        60
     gccctgctga tcggcctgct caaatcgcct tgggccaagg ggcagatcgg tgaactgctg       120
     gtgcgcctgt tcgcccattg gcagctggac aggcaaacct accgccgcct gcacaacgtc       180
     accctgaaca cgccggacgg cacgacacag atcgaccacg tatttttctc accctacggc       240
     atcttcgtgc tggaaacggc aggtttccag cacctgccga taggtctcta ccgttgcacc       300
     ggcgagccgt gctgcaggtc acaggctttg gcatga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page