(data stored in ACNUC7421 zone)

EMBL: CP000438.PE59

CP000438.PE59        Location/Qualifiers
FT   CDS_pept        70324..71028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00700"
FT                   /product="putative protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15015"
FT                   /db_xref="GOA:A0A0H2ZJP1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJP1"
FT                   /protein_id="ABJ15015.1"
FT                   /translation="MNDLTLHYLYDPLCGWCYGASPLLAAAREVTGLDVRLHGGGMMTD
FT                   ANRQPVGAGLRHYVMPHDLRIAQLTGQPFGKDYFDGLLRDTSAVFDSAPPTAAVLAAEA
FT                   LDGLGAAMLARIQRAHYVEGRRIAERPVLLELGAELGLGEGFAEAFDACSGEPLRAHFA
FT                   DSRRLMNRLGAAGFPTFALERDGRLQVLDTGRYLGQPDDWRAFLETQLRLAGGSGALGG
FT                   AAAPLCRIDGCA"
     atgaacgacc tcaccctgca ttacctctac gatccgctct gcggctggtg ctacggcgcc        60
     tcgccgctgc tcgccgccgc ccgcgaggtg acgggtctgg acgtacgcct gcatggcggc       120
     ggcatgatga ccgatgccaa ccgccagccg gtcggcgccg gtctgcgcca ctacgtgatg       180
     ccccatgacc tgcggatcgc ccaactgacc ggccagccgt tcggcaagga ctacttcgac       240
     ggcctgctgc gcgacaccag cgcggtattc gactcggccc cgccgaccgc cgccgtgctt       300
     gccgccgaag cgctcgacgg cctcggcgcg gcgatgctgg cgcggatcca gcgtgcccac       360
     tacgtcgagg gccggcgtat cgccgagcgt ccggtgctgc tcgagctggg tgccgaactg       420
     gggcttggcg agggcttcgc cgaggcgttc gacgcctgct ccggcgagcc gctgcgcgcg       480
     cacttcgccg acagtcggcg gctgatgaac cgtctcggcg ccgctggctt cccgaccttc       540
     gccctggagc gcgacggccg cctgcaggtg ctcgacaccg ggcgctacct cggccagccg       600
     gacgactggc gggctttcct cgaaacgcag ctgcgccttg ccggcggcag cggtgccttg       660
     ggcggggccg cggcgccgct ctgccgcatc gacggttgcg cctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page