(data stored in ACNUC7421 zone)

EMBL: CP000438.PE590

CP000438.PE590       Location/Qualifiers
FT   CDS_pept        complement(638737..639858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07450"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15536"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLR2"
FT                   /protein_id="ABJ15536.1"
FT                   /translation="MNDPLWIWQQPDWPQFNWQAEALAPLLRSCSQAQGRLLGMLGAVG
FT                   SDTEVQSSLDAMLQNIVTSSAIEGEQLNVGSVRSSLARRLGLHEEGRTTSRSEGLAELL
FT                   LDATHAHQEPLDEQRLFTWHSWLFPTDDQLLARPLHIGALRGEEPMQVVSGRIDRPTVY
FT                   FEAPPRAGLEAQLADFLAWFESSRSDASLDPFLRAGIAHFWFVTLHPFDDGNGRLTRAI
FT                   TDLALAQGEQQAIRFYAMSASILDDRAGYYRILEASQKGGLDITKWLQWFLETLLKSLE
FT                   QALARIDRVLVKARFWQAHRSQTLSAEQIKVLNRLLDGGERGFEDGISAAQYQAVAKVS
FT                   KATATRHLSDLLEKGCIERLPGGGRSTRYQIAR"
     atgaacgacc cactctggat ctggcagcag cccgactggc cgcagttcaa ctggcaagcc        60
     gaagcgcttg caccactgct gcgctcctgt agccaggctc agggtcgttt gttaggaatg       120
     ctcggtgccg tggggagtga caccgaagtg cagagcagcc tggatgccat gctgcagaac       180
     atcgtcacct cttcagccat tgagggagag caactgaatg tcggttcggt gcgctcatca       240
     ctggcacggc gactgggatt gcacgaagaa ggtcgaacca cctctcgctc cgaaggcctg       300
     gcggaactgc tgctcgatgc cacccacgca catcaagagc cgctagacga acagcgactg       360
     ttcacctggc acagttggtt attccccacc gatgaccaac ttctggctcg accactacac       420
     atcggcgcac tgcgcggcga agagcccatg caggtagttt cgggtcggat agaccgccct       480
     accgtatatt tcgaagcccc tccccgcgca gggttggaag cgcaactggc ggactttctc       540
     gcctggttcg aaagcagccg cagcgatgcc agcctcgacc cctttctgcg cgccggtatc       600
     gcacatttct ggttcgtgac cctgcatccc ttcgacgacg gcaacggtcg cctcacccgc       660
     gctatcaccg atctggcatt ggctcagggc gagcagcaag ccattcgctt ctacgccatg       720
     tctgcgagca tcctcgacga ccgcgccggc tattaccgca tcctagaagc cagtcagaaa       780
     ggcgggctgg atatcaccaa gtggctgcag tggtttctcg aaaccttgct caagagcctg       840
     gagcaagccc ttgcccgtat agaccgcgtg ctggtcaagg cgcgcttctg gcaggcacat       900
     cgcagccaaa cgctatcggc ggagcagatc aaagtgctta accgcctgct cgatggcggc       960
     gaaagggggt tcgaggacgg catcagtgcg gcgcaatacc aagctgtggc caaggtttcc      1020
     aaagccaccg cgacccgtca cttgagcgac ctgctggaaa agggctgcat cgagcgactg      1080
     cccggcggag ggcgtagcac ccgttaccag atagcacgct ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page