(data stored in ACNUC7421 zone)

EMBL: CP000438.PE593

CP000438.PE593       Location/Qualifiers
FT   CDS_pept        complement(643347..647084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07500"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15539"
FT                   /db_xref="GOA:A0A0H2ZLJ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ7"
FT                   /protein_id="ABJ15539.1"
FT                   /translation="MQRLQAVLLLCLACCWPGLAGALTLTPEERAWLAEHPSIRLGVDT
FT                   SWPPFEFRDEQGRYQGLAAGYVSLLQERLGVSLTPVEPKTWTQVLEQAKDGRLDLLPGI
FT                   MATPERQEYLSFTRPYLDFPIIILARKNGPMPKRIDELYGLKVAVVDHYAPHELLIAQH
FT                   PDLTLLPLPSVAAALQALATGQADAFVGDFASSVWNLRQLKLNGLEISGETPYRYQLAM
FT                   AVPRGQPILAGIVDKVLADLSAEEIERLQAPWVGGLLDRRPAWREMATYGLPIVLLILV
FT                   SVAILLAMNRRLRREVSRRRQLERELRDSEQHYRGLVESLNAIAWEMRLEENRFTYVSP
FT                   HAERLLGYPLGEWLQPGFWQRTLHPMDAEYAIHYCMSESQAGRDHSFDYRMLAADGRVV
FT                   WIRDLVTPIAQGRDLLLRGLMIDITEAKLTEQAMRLSEQKFASVFHHCPDMVVLANGAD
FT                   GRFLAVNNTFEQQIGIAADDAIGKTATELGIWALPGLGPQVLEKLGHGNLTNLEVPLRR
FT                   RNGSTFSALLSAQHVALDQTPALVVVIRDITHLVETQELLRISEEKFANAFHAYPDGLL
FT                   ISRLEDGTLIDVNEGFTRLTGYRRDEVISRSTLELGLWVDTEDRKRLISLVRHHTLTQG
FT                   FTAPVRDRNGGIRQCEMSAHRISIDGEDCVLTIARDITERQLMQEKLQQAATVFESTAE
FT                   GVMITDTRQRITAVNRAFSEITGYSEQEALGRSPSLLSSGQHDSSFYLAMWNQLERDGH
FT                   WQGEIWNRRKTGELYPEWLTISAVHNPQGEITHFVGVFADISTLKYAQARLDYQAHHDP
FT                   LTGLPNRLLFESRLNHALDEAREESRPGAVLFIDLDRFKHINDSLGHPIGDLLLKAIAE
FT                   RLRDQLRDVDTVARLGGDEFIILLPGLHQESDAEHVARKLLNAFTAPFQAEGHEFFVSA
FT                   SVGIALFPKDGDDAPTLVKNADAAMYRAKSRGRSRIEYYTRELTYLATERMALETELRR
FT                   ALERDELQLYYQPKLSLESGLLVGAEALVRWYHPLFGEISPERFIPLAEDCGLILPLGD
FT                   WVLGHACQQMGEWQKLHAPFGPLSVNLAGAQLGQPQLIERLEQLLEQSGLEPSRLQLEI
FT                   TESFIMNQTEEALAVLHGLKRLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGL
FT                   PDDPHDAAITRAIIALGRSMQLTVIAEGVETEGQQSFLTHEGCEQIQGFVLSPPLPAEL
FT                   FASKFLKPRQPIGAPREAPV"
     atgcagcgtc tgcaggccgt gcttctcctg tgtctggcct gctgctggcc ggggctggcc        60
     ggcgccctca cgctcacgcc cgaggaacgg gcctggctgg ccgagcaccc gagcatccgc       120
     ctgggcgtgg acacctcctg gccgccattc gagttccgcg acgaacaggg ccgctaccag       180
     ggactcgccg ccggctacgt cagcctgctg caggaacgcc tgggcgtcag cctgacgcct       240
     gtcgaaccga agacctggac gcaggtcctg gagcaggcca aggacggtcg gctggacctg       300
     ctgcccggca tcatggctac cccggagcgc caggagtatc tgagcttcac ccggccctac       360
     ctggacttcc cgatcatcat cctggcacgc aagaacggcc cgatgccgaa gcgcatcgac       420
     gagctctacg gactcaaggt cgcggtggtc gaccactatg ctcctcacga actgctgatc       480
     gcccagcatc ccgacctcac cctgctgccg ctgccttcgg tagcggcagc cctgcaggcg       540
     ctggccaccg gccaggccga cgccttcgtc ggcgacttcg cctccagcgt atggaacctc       600
     cgccagctca agctcaacgg cctggagatc agcggcgaga cgccataccg ctaccaactg       660
     gcgatggccg tgccgcgcgg acaaccgatc ctcgccggga tcgtcgacaa ggtcctcgcc       720
     gacctcagcg ccgaggagat cgagcgactc caggccccct gggtcggcgg cctgctcgac       780
     cgacgtccgg cctggcgcga gatggcgacc tacggccttc ccatcgtcct gctgatcctg       840
     gtctcggtcg ccatactgct ggccatgaac cgccgcctgc gccgcgaggt gagtcgccgg       900
     cggcaattgg agcgcgaact gcgcgacagc gaacagcact accggggact ggtggaaagc       960
     ctgaatgcca ttgcctggga aatgcgcctc gaggagaacc gcttcaccta cgtctcgccc      1020
     cacgccgaac gcctgctcgg ctatcccctc ggcgaatggc tgcagccggg cttctggcag      1080
     cggaccctgc accccatgga cgccgagtac gccatccact actgcatgag cgaaagccag      1140
     gccggacgcg accacagctt cgactaccgg atgctcgccg ccgacggccg ggtggtctgg      1200
     attcgcgatc tggtcacccc gatcgcgcaa ggccgggacc tgctcctgcg cggtctgatg      1260
     atcgacatca ccgaggccaa gctcaccgag caggccatgc gcctgtccga acagaagttc      1320
     gcttcggtgt tccaccactg tccggacatg gtggtactgg ccaatggcgc cgacggccgc      1380
     ttcctcgcgg tgaacaacac cttcgagcag cagatcggca tcgccgccga cgacgccatc      1440
     ggcaagaccg ccaccgaact gggcatctgg gcactccccg gcctgggccc gcaggtcctg      1500
     gaaaagctcg gccacggcaa cctgaccaac ctcgaggtgc ccctgcggcg ccgcaatggc      1560
     agtaccttca gcgcgctgct cagcgcccag cacgtggccc tcgaccagac accggcgctg      1620
     gtggtggtga tccgcgacat cacccacctg gtggagaccc aggaactgct gcggatctcc      1680
     gaggagaagt tcgccaacgc cttccatgcc taccccgacg gtctgctgat cagccgcctc      1740
     gaagacggca cgctgatcga cgtgaacgaa ggcttcaccc gtctcaccgg ctaccgccgc      1800
     gacgaggtca tctcccgctc cacgctcgaa ctcggcctgt gggtcgacac cgaggaccgc      1860
     aagcgcctga tctcgctggt acgccaccac accctgaccc agggcttcac cgcccctgta      1920
     cgggaccgca acggtggcat ccgccagtgc gagatgtccg cccaccggat cagcatcgat      1980
     ggcgaggact gcgtgctgac catcgcccgc gatatcaccg agcgccagct catgcaggag      2040
     aagctgcagc aggccgccac cgtcttcgaa agcaccgccg aaggcgtgat gatcaccgat      2100
     acccgccaac gcatcaccgc ggtcaaccgc gccttcagcg agatcaccgg ctacagcgag      2160
     caggaggcgc tgggacgctc gcccagcctg ctctcctccg gacaacacga ctccagcttc      2220
     tacctcgcca tgtggaacca gttggaacgc gacgggcact ggcagggcga gatctggaac      2280
     cgacgcaaga ccggcgagct gtaccccgaa tggctgacca tcagcgcggt acacaatccg      2340
     cagggcgaga tcacccactt cgtcggcgtc ttcgccgata tctccaccct caagtacgcc      2400
     caggcccggc tcgactacca ggcccaccac gatccgctca ccggcctgcc caatcgcctg      2460
     ctgttcgaga gccggctcaa tcacgccctc gacgaggccc gcgaagagag ccgtcccggc      2520
     gccgtgctgt tcatcgacct ggaccgcttc aagcacatca acgacagcct cggccatccc      2580
     atcggcgacc tgctgctcaa ggccatcgcc gaacgcctgc gcgaccagtt gcgcgacgtc      2640
     gataccgtgg cccgcctggg gggcgacgaa ttcatcatcc tgctcccagg cctgcaccag      2700
     gaaagcgacg ccgagcacgt cgcgcgcaag ctgctgaatg ccttcaccgc gccgttccag      2760
     gccgaaggtc atgaattctt cgtcagcgcc agcgtcggca tcgccctgtt ccccaaggac      2820
     ggcgacgacg ccccgaccct ggtgaagaac gccgacgccg ccatgtaccg cgccaagtcg      2880
     cggggccgca gccgcatcga gtactacacc cgcgaactga cctacctggc caccgagcgc      2940
     atggcgctgg aaaccgaact gcgccgcgcc ctcgagcgcg acgagttgca gctctactac      3000
     caacccaagc tgagcctgga gagtggcctg ctggtcggcg ccgaggcact ggtgcgctgg      3060
     taccatccgc tgttcgggga aatttccccg gagcgcttca tccccctcgc cgaggattgc      3120
     ggcctgatcc tgcccctcgg cgactgggtg ctgggacacg cctgccagca gatgggcgaa      3180
     tggcaaaagc tgcacgcgcc gttcggcccg ctgtcggtca acctcgccgg cgcccagctc      3240
     ggccagccgc aactgatcga acgcctcgag caactgctgg agcagtccgg cctggaaccg      3300
     tcgcggctgc aactggaaat caccgagagc ttcatcatga accagaccga ggaggccctc      3360
     gccgtcctcc acggcctcaa gcgcctcggc gtacagctgg cgatcgacga cttcggcacc      3420
     ggctactcct cgctcagcta cctcaagcgc ctgccgctgg acatcctgaa gatcgacaag      3480
     tcgttcatcc gcggcctccc cgacgatccc cacgatgccg ccatcacccg cgccatcatc      3540
     gccctcggcc gcagcatgca gctcacggtg atcgccgaag gcgtggaaac cgaaggccag      3600
     cagagcttcc tcacccacga aggctgcgag cagatccagg gcttcgtcct cagcccgccg      3660
     ctgccggccg agctgttcgc cagcaaattc ctcaaaccgc gccagccgat tggcgctccc      3720
     cgagaagcgc cggtataa                                                    3738
//

If you have problems or comments...

PBIL Back to PBIL home page