(data stored in ACNUC7421 zone)

EMBL: CP000438.PE596

CP000438.PE596       Location/Qualifiers
FT   CDS_pept        complement(651201..651650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15542"
FT                   /db_xref="GOA:A0A0H2ZKW8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKW8"
FT                   /protein_id="ABJ15542.1"
FT                   /translation="MSEIKSRLLDAVKVAMRAQDKPRLTTLRLALADIKRVEVDERIEV
FT                   DDARALLILDRMIKQRRDAQRQFSDAGRQDLAEVEAAEILVLQDFMPKPLDDHEINALI
FT                   ERSIVDSGAQGPQDMGKAMNLLRPQVQGRVDMAQVSQRLKARLSS"
     atgagcgaaa tcaaatcccg cctcctcgac gccgtcaagg tcgccatgcg cgcccaggac        60
     aagccgcggc tgaccacgtt gcgcctggcc ctcgcggaca tcaagcgcgt cgaagtcgac       120
     gaacgcatcg aggtggatga cgcccgagcc ctgctgatcc tcgaccggat gatcaagcag       180
     cgccgcgacg cccagcgcca gttcagcgac gccggccgcc aggacctcgc cgaggtcgag       240
     gccgccgaga tcctcgtgct ccaggacttc atgcccaagc ccctggacga ccatgagatc       300
     aacgccctga tcgagcgcag catcgtcgac agcggcgccc agggtccgca ggacatgggc       360
     aaggcgatga acctgctgcg accgcaggtc cagggtcgcg tcgacatggc acaggtcagc       420
     cagcgcctga aggcgcgcct ctcctcctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page