(data stored in ACNUC7421 zone)

EMBL: CP000438.PE599

CP000438.PE599       Location/Qualifiers
FT   CDS_pept        complement(653240..653809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07580"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07580"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15545"
FT                   /db_xref="GOA:Q02TI2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TI2"
FT                   /protein_id="ABJ15545.1"
FT                   /translation="MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLR
FT                   VAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKG
FT                   VATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPM
FT                   TVLTGLIVWRHRANLRDLFAGRERHF"
     atggtctggc tactggcgat cctcgcctac ctgctcggtt ccctctcctt cgccgtcctg        60
     ctcagccgct ggttcggcac ccaggacccg cgcgccagcg gttccggcaa ccccggcgcg       120
     accaacatgc tgcgcgtcgc cgggaagaaa ctcgccatcc tgaccctgct cggcgacgtc       180
     ggcaaaggcc tgctgccggt gctggtcgcc cgctggctgg ggctcggcgt gatggaggag       240
     gcctgggtcg gcatcgccgc cgtgatcggc cacctgtacc cgctgtactt caacttccgc       300
     ggcggcaagg gtgtcgccac cgccgcgggc atgctcctcg gcctctatcc gccggccgta       360
     ctgctggccg cggcggcctg gctgctgacc ttcaagctgt cgcgcaccag ctcgctcgcc       420
     tcgctggtgg ccaccccgct gaccctgccg ttgctggcct ggcagcagcc cggagcgctg       480
     ctgccgatga ccgtgctgac cggcctgatc gtctggcggc accgcgccaa cttacgcgat       540
     ctgttcgccg gccgcgaacg gcatttctaa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page