(data stored in ACNUC7421 zone)

EMBL: CP000438.PE603

CP000438.PE603       Location/Qualifiers
FT   CDS_pept        complement(656028..656534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15549"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB0"
FT                   /protein_id="ABJ15549.1"
FT                   /translation="MRLFAIVLLCLVLATCASHIPSARVTHPASAGLPGLQGFQLMPPE
FT                   QAVDALPYRNRYPLINAELRQGLAAHGYHESATPQFRVYYWLALRDAPLEFRPDLPPTS
FT                   GMGPYLAIHRLRDETGTLRVRLVDLEERVLWEGMVSTGLSPARANPEQLELVVGALLRQ
FT                   LPRAR"
     atgcgcctgt tcgccatcgt cctgctctgc ctcgtcctgg ccacctgcgc cagccacatc        60
     cccagcgccc gggtgaccca tccggccagc gccggactgc ccggcctgca aggtttccag       120
     ttgatgccgc cggaacaggc ggtcgacgcc cttccctacc gcaaccgcta tccgctgata       180
     aacgcagagc tgcgccaggg actggcggcc cacggctacc acgagagcgc taccccgcaa       240
     ttccgcgtct actactggct ggcgctacgc gacgcaccgc tggagttccg ccccgacctt       300
     ccgcccacct ccggcatggg gccttatctg gcgatccacc gcctgcgcga cgaaaccggg       360
     acattgcgcg tgcgcctggt cgacctggag gagcgcgttc tctgggaagg tatggtaagc       420
     accggcctca gccccgccag ggccaatccg gaacagctcg aactggtggt cggcgccctg       480
     ctccggcagc ttccacgcgc ccgctag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page