(data stored in ACNUC7421 zone)

EMBL: CP000438.PE605

CP000438.PE605       Location/Qualifiers
FT   CDS_pept        complement(658179..659450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07660"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15551"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TH6"
FT                   /protein_id="ABJ15551.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSITD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGRQTVVHPGNKEFTAGEHIARPSGGGGGRGGGKAS
FT                   NSGEGMDDFVFQITQEEFLDFMFEDLELPNLVKRHITGTDTFKTVRAGISNDGNPSRIN
FT                   IVRTLRSAHARRIALSGGSRAKLRAALKELERIKREEPDNLGDIQELELEIAKLRARID
FT                   RVPFLDTFDLKYNLLVKQPNPTSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YEKIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKMMQEIMAERYPTHEWNIYAA
FT                   QASDGDNWNDDSPVCRDILLKQIMPFVQYYTYVEITPREHQALWFEYERVREAFEDSFA
FT                   QQQIVSASDIYPVFRELFQRRLVA"
     atgagctacg tcatcgaccg gcgtctgaac ggcaagaaca agagcacggt gaaccgccag        60
     cgcttcctga ggcgctaccg tgaacacatc aagaaggccg tcgaggaggc cgtcagccgg       120
     cgttccatca ccgacatgga gcacggcgag cagatcagca ttcccgggcg cgatatcgac       180
     gaaccggtgc tgcaccatgg ccgcggcggg cggcagaccg tcgtccaccc cggcaacaag       240
     gaattcaccg ccggcgagca catcgcccgc ccatccggcg gcgggggcgg ccgcggcggc       300
     ggcaaggcca gcaacagcgg cgaaggcatg gacgacttcg tcttccagat cacccaggag       360
     gaattcctcg acttcatgtt cgaggacctg gagctgccca acctggtcaa gcgccacatc       420
     accggcaccg acaccttcaa gaccgtccgc gccggcatca gcaacgacgg caacccgtcg       480
     cgcatcaaca tcgtccgcac cctgcgctcg gcccatgcgc ggcgcatcgc gctgtccggc       540
     ggcagccggg ccaagctgcg cgcggcgctg aaggaactgg agcggatcaa gcgcgaagaa       600
     ccggacaacc tcggcgatat ccaggaactc gagctggaaa tcgccaagct ccgcgcgcgc       660
     atcgaccggg tgccgttcct cgataccttc gatctcaagt acaacctgct ggtcaagcag       720
     cccaacccca cctccaaggc ggtgatgttc tgcctgatgg acgtctccgg ctcgatgacc       780
     caggcgacca aggacatcgc caagcgcttc ttcatcctgc tctacctgtt cctcaagcgg       840
     aactacgaga agatcgaagt ggtgttcatc cgccaccaca ccagcgcccg cgaggtcgac       900
     gaggaggagt tcttctactc ccgcgagacc ggcggcacca tcgtctccag cgcgctgaag       960
     atgatgcagg agatcatggc cgagcgttat ccgacccatg agtggaacat ctacgccgcc      1020
     caggcctcgg acggcgacaa ctggaacgac gactcgccgg tgtgccggga catcctcctc      1080
     aagcagatca tgccgttcgt ccagtactac acctacgtcg agatcacccc gcgcgaacac      1140
     caggccctgt ggttcgagta cgagcgcgtg cgcgaagcct tcgaagacag cttcgcccag      1200
     cagcagatcg tctcggcatc ggacatctac ccggtgttcc gcgagctgtt ccagaggagg      1260
     ctcgtcgcat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page