(data stored in ACNUC7421 zone)

EMBL: CP000438.PE61

CP000438.PE61        Location/Qualifiers
FT   CDS_pept        71678..71911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15017"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJY2"
FT                   /protein_id="ABJ15017.1"
FT                   /translation="MKTIGLGIATLLFSATALAAPKPCEELKAEIETKIQSAGVTSYTL
FT                   EIVRNDEVSDPNMVVGSCENGTKKIIYQKNDD"
     atgaaaacca tcgggctggg gattgccacc ttgctgttca gcgccacggc gctggccgcg        60
     ccgaagccgt gcgaggaact caaggcggag atcgagacca agatccagtc ggccggggtg       120
     acctcctaca ccctggagat cgtgcgcaac gacgaagtca gcgacccgaa catggtggtc       180
     ggcagttgcg agaacggcac caagaagatc atctaccaga agaacgacga ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page