(data stored in ACNUC7421 zone)

EMBL: CP000438.PE617

CP000438.PE617       Location/Qualifiers
FT   CDS_pept        complement(671923..672984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15563"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLL6"
FT                   /protein_id="ABJ15563.1"
FT                   /translation="MPAFSLLPKPSALLPLLLAAAFLPPAFVQAEEEAAKDQPPAPVER
FT                   PAVSERSQDEAKGLERQLPEDGQQILKAGDESFLTLWLPANTAEAEGVVILVPGDGESP
FT                   DWPQAIGPLRRKLPDAGWQTLSLALPDPQSTAPVTRPAESAASASADKDASAADSASKP
FT                   DVKGESGNAPAPESTAEAGSGEPAQSEDQAPPPAIDPVEQRKAHAERVMARLQASIDLA
FT                   LQHEPKSVVLLGHGTGAYWAARYLAEKEPAEIHNLLLVAAEVPRDFRPALEDMVPKLKL
FT                   ATGDFYYRDARADREAARLRMQAGKRQKHPAYVQIAMQALPADPKAEQEQLYRRIRGWL
FT                   SLHLQADAQKPAE"
     atgccggcct tctctctact gccgaagccc tccgccctgc tgcccctgct attggccgcc        60
     gctttcctgc cgccggcttt cgttcaagcc gaagaggagg ccgccaagga ccagccgccg       120
     gcccccgtgg aacgcccggc ggtcagcgag cgcagccagg acgaggccaa ggggctggag       180
     cgccagttgc cggaggacgg ccagcagatc ctcaaggccg gcgacgaaag cttcctcacc       240
     ctctggttgc cagccaacac cgccgaggcc gaaggtgtag tgatcctggt tcccggtgat       300
     ggcgaaagtc cggactggcc gcaagccatc ggcccgctaa ggcgcaaact gccggatgcc       360
     ggctggcaga ccctgagcct ggccctgccc gacccgcaga gcaccgcgcc ggttacccgc       420
     cctgcggaat ccgccgccag cgccagcgcc gacaaggacg ccagcgccgc ggacagcgca       480
     agcaagcctg acgtgaaagg cgaaagcggc aacgcgccgg cgccggaaag caccgccgaa       540
     gccggcagcg gcgaaccggc gcagagcgag gaccaggccc ctcccccagc catcgatccg       600
     gtcgagcagc gcaaggcgca cgccgaacgg gtcatggcgc gcctgcaggc gagcatcgac       660
     ctggccctgc agcacgaacc gaaaagcgtc gtcctgctcg gtcatggcac gggcgcctat       720
     tgggcggcac gctacctggc ggagaaggag cctgcggaaa tccacaacct gctgctggtt       780
     gccgcggagg taccgcgcga ttttcgcccg gcgctggaag atatggtgcc gaagctgaaa       840
     ctggcgaccg gcgacttcta ttaccgcgac gcccgcgccg accgcgaggc ggccaggctg       900
     cgcatgcagg ccggcaagcg gcagaaacac ccggcctacg tacaaatcgc gatgcaggct       960
     ctaccggccg accccaaggc ggagcaggag caactgtacc gacgaatccg cggctggctc      1020
     agtcttcacc tgcaggccga tgcgcagaaa cctgcggagt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page