(data stored in ACNUC7421 zone)

EMBL: CP000438.PE618

CP000438.PE618       Location/Qualifiers
FT   CDS_pept        673136..675529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07820"
FT                   /product="putative histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15564"
FT                   /db_xref="GOA:A0A0H2ZLB8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLB8"
FT                   /protein_id="ABJ15564.1"
FT                   /translation="MLRRCCLLFFCLLLSLPVRAEESVALPLTAELRTWLAEHRELRVG
FT                   VVTEAPYAQYDRRLQQYSGANVELMGWLATAMQVTLRWQGYPDQAALDDALRAGRVDIA
FT                   PGLSQTPAGLRLWLFSDPYLRVSRLVVGKRDGSGSVELEQLERDTRVAVRAGSSVADYL
FT                   SSTYSSLQWVSADSEREVLRAVLAGQARYAVIDEAQLSRLTREPEFAELAVVGDIGYPQ
FT                   LLRVATRRDWPELAMVVDQALRSLPRKSLDQLHERWLQPKYPRLGESPGFWQNLSILLG
FT                   LLLAGALAAVFLQRRQQHALEARLYGARRDLELRQAAEEALRLTQFSIDNSTLGILWVN
FT                   WDSRVRYANRAAEQMLGHADGQLVDRPLADFEPGLDMDRWLNLWRRARNSEEGPLSFET
FT                   RCLRADGSWLPADVSLSFLRFGTSEYLVVFLSDVTERRRAREALQESEARMKGIASNVP
FT                   GMVFRLERPRAGAFSDFAYISEGSEALVGYSALELIESGRGIRGLVHPDDRERYWSSQM
FT                   AALDENRDWHWQGRILTRQGELRWADIKASARCFEDGRAVWDGVVWDITANKQIELELG
FT                   ESRAQLRELSAHLESVREEEKARIAREVHDELGQVLTVLKLETSMCELAYADAQEGLRE
FT                   RLGNMKKLIAQLFQLVRDVATALRPPILDAGIGSAVEWQARRFEARTQIPCLVEVPENS
FT                   PQLVDAKAIGLFRILQEALTNVMRHAEAHTVQLRLLREGDELCLSVSDDGRGFDVATVG
FT                   RGSSFGLVGMRERVLMMGGTLDIDSAPGEGTTLSVRIPLGVASP"
     atgttgcgtc gttgctgtct gctcttcttc tgtctgctgt tgagcctgcc cgtgcgagcg        60
     gaggagtcgg tcgccttgcc gctgacggca gaactacgga cctggctggc ggagcatcgg       120
     gaattgcgcg tcggggtggt caccgaagcg ccctatgccc agtacgaccg ccgcctgcaa       180
     cagtattccg gggccaacgt ggagctgatg ggctggctgg ccacggcaat gcaggtgacc       240
     ttgcggtggc agggctatcc cgaccaggcg gcgctcgacg atgccctgcg cgctgggcgc       300
     gtggatatcg ctcccggcct cagccagacc ccagccgggc tgcgcttgtg gctgttctcc       360
     gatccctacc tgcgggtttc ccggctggtg gtggggaagc gcgatggcag cggcagcgtc       420
     gaattggagc aactggagcg cgatacccgg gttgccgtgc gtgccggcag ttcggtagcc       480
     gactacctca gcagcaccta tagcagcctg caatgggtgt cggccgattc cgaacgcgag       540
     gtgctgcgcg ccgtgctcgc cggacaggca cgctacgcgg tgatcgacga agcgcaactc       600
     agtcgcctga cccgcgaacc ggagttcgcc gagctagcgg tggttggcga tatcggctac       660
     ccgcagctgc tacgggtggc gacccgtcgc gactggccgg aactggcgat ggtggtcgac       720
     caggcgttgc gctcgctgcc gcgcaagtcc ctggaccagt tgcacgagcg ctggttgcaa       780
     cccaagtatc cgcgcctcgg cgagtcgccg gggttctggc agaacctgtc gatcctcctc       840
     ggcctgctgc tggccggcgc gctggcggcg gtgttcctcc agcggcgcca gcagcatgcg       900
     ctggaagccc ggctgtacgg cgcccgccgc gacctggagc tgcgccaggc ggccgaggag       960
     gcgctgcgcc tgacccagtt ctccatcgac aacagcaccc tgggcatcct ctgggtcaac      1020
     tgggacagcc gcgtacgcta cgccaaccgc gccgccgaac agatgctcgg ccatgccgac      1080
     ggccaactcg tggaccgtcc gctggccgac ttcgagcccg gcctggacat ggaccgctgg      1140
     ttgaatcttt ggcgtcgtgc gcgcaatagc gaggagggcc cgctcagctt cgagacccgc      1200
     tgcctgcgcg ccgacggcag ttggctgccg gccgacgtct cgcttagctt cctgcgcttc      1260
     ggcacgtccg agtatctggt ggtgttcctc agcgacgtca ccgagcgccg ccgtgcccgc      1320
     gaggcattgc aggaaagcga ggcgcggatg aagggcatcg cctccaacgt gccgggcatg      1380
     gtcttccgcc tggagcgccc gcgggccggc gcgttttccg acttcgccta tatcagcgag      1440
     ggcagcgagg cgctggtcgg ctacagcgct ctcgagctga tcgagagcgg ccgcggcatt      1500
     cgtggcctgg tccatcccga cgaccgcgag cgctactggt cgagccagat ggctgccctc      1560
     gacgagaatc gcgactggca ttggcagggc cgcatcctca cccgccaggg cgaattgcgc      1620
     tgggccgaca tcaaggcttc ggcgcgctgt ttcgaggatg gtcgcgcggt ctgggacggg      1680
     gtggtctggg acatcaccgc gaacaagcag atcgaactcg aactcggcga gtcgcgcgcc      1740
     cagctccgcg agctgtcggc gcacctggag tcggtgcggg aggaggagaa ggcgcgtatc      1800
     gcccgcgagg tccatgatga gctgggccag gtgctgacgg tgctgaagct ggaaacctcg      1860
     atgtgcgagc tggcctatgc cgatgcccag gagggcctgc gcgaacgcct gggcaacatg      1920
     aaaaagctga tcgcccagtt gttccagctg gtgcgcgacg tggccaccgc actgcgcccg      1980
     ccgatcctcg acgccggaat cggctcggcg gtggagtggc aggcgcggcg cttcgaggcg      2040
     cgcacgcaga ttccctgcct ggtggaggtg ccggagaact cgccgcagtt ggtcgacgcc      2100
     aaggctatcg gcctgttccg catcctccag gaggcgttga ccaatgtcat gcggcatgcc      2160
     gaggcgcata ctgtgcaact gcgtctgctg cgcgagggcg acgagctgtg cctgagcgtc      2220
     agcgacgacg gtcgcgggtt cgatgttgcc acggtggggc gtggcagttc cttcggcctg      2280
     gtcggcatgc gtgagcgggt gctgatgatg ggcggtacgc tggacatcga cagtgccccc      2340
     ggcgagggca ccacgctcag cgtgaggatt ccgctgggcg tcgcgagccc gtga            2394
//

If you have problems or comments...

PBIL Back to PBIL home page