(data stored in ACNUC7421 zone)

EMBL: CP000438.PE620

CP000438.PE620       Location/Qualifiers
FT   CDS_pept        676336..677370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07850"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07850"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15566"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKY3"
FT                   /protein_id="ABJ15566.1"
FT                   /translation="MLPAMRTGLLCALLGVTAPAWAEYVTVISFGGANKEAQETAFYKP
FT                   FKSATGNRVVHGSYNGDLAKLKRMVEISHVSWDVVEVEAPELARGCEEGLFEKLDMAKV
FT                   GDPADFVPGAVQPCGVGIFVWTTLLAYNPGKVAGSPQGWADFWDVKKFPGKRGLRWGAK
FT                   YSLEFALMADGVAPKDVYQTLATPAGVERAFRKLDELKPYIHWWKSGQDPVRDLADGTV
FT                   VMSSAYNGRIAAAQAEKQPLAMVWSGGVYDFDFWALPVGVWKKQLAEEFIRFASQPEQQ
FT                   KAFAENIAYGPANRKAVGLLDPQVAASLPTAPQNMQNAVGMNVAFWAEHGEALEQRFQN
FT                   WAKR"
     atgttgccag ccatgaggac gggcctgttg tgcgcccttc tcggagttac cgcgcccgcc        60
     tgggcggaat acgtgaccgt gatttccttc ggcggcgcca acaaggaagc ccaggaaacc       120
     gcgttctaca aacccttcaa gagcgccacc ggcaatcgcg tggtgcatgg ctcctacaat       180
     ggcgacctgg ccaagctcaa gcgcatggtg gagatcagcc acgtctcctg ggacgtggtg       240
     gaagtcgagg cgccggagct ggcgcgcggt tgcgaggaag gtctgttcga gaagctggac       300
     atggcgaagg tcggcgatcc cgcggatttc gttcccggcg cggtgcagcc ctgcggagtc       360
     ggcatcttcg tctggaccac gctgcttgcc tacaaccccg gcaaggttgc gggcagcccg       420
     cagggctggg cggatttctg ggacgtgaag aagtttcccg gcaagcgcgg cctgcgctgg       480
     ggcgccaagt acagcctgga gttcgccctg atggccgatg gcgtggcgcc gaaggacgtc       540
     taccagacgc tggcgacgcc cgccggcgtc gagcgggcat tccgcaagct cgacgagctg       600
     aagccctata tccattggtg gaagtccggg caggaccctg tgcgcgacct ggccgatggc       660
     acggtggtga tgagttcggc ctacaacggg cggatcgccg cggcgcaggc cgagaagcag       720
     cccctggcaa tggtctggag cggcggcgtc tacgatttcg acttctgggc gctgccggtc       780
     ggggtttgga agaagcagtt ggccgaggag ttcatccgtt tcgccagcca gccggagcag       840
     cagaaggctt tcgccgagaa catcgcctac ggcccggcca accgcaaggc ggtaggcctc       900
     ctcgatccgc aagtggctgc cagcctgccg accgcgccgc agaacatgca gaacgcggtg       960
     ggtatgaacg tggccttctg ggcggagcac ggcgaggccc tggagcagcg tttccagaac      1020
     tgggccaagc gctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page