(data stored in ACNUC7421 zone)

EMBL: CP000438.PE622

CP000438.PE622       Location/Qualifiers
FT   CDS_pept        678769..679815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07870"
FT                   /product="putative binding protein component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15568"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLM1"
FT                   /protein_id="ABJ15568.1"
FT                   /translation="MSKSLKAASLKFATLAAGLACAAQAMAVDLTVVSFGGANKSAQIK
FT                   AFYEPYQKATGNRIVAGEYNGEMAKVKAMVDTNSVSWDLVEVESPELSRGCDEGLFEEL
FT                   DPAQFGKTEDFVPGAIQPCGVGFFVWSTVLAYNADKLKSAPTSWADFWDIKKFPGKRGL
FT                   RKGAKYTLEFALMADGVAPKDVYGVLATKEGQDRAFKKLDEIKSSIQWWEAGAQPPQYL
FT                   ASGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKKQEETLKFIAFSVQ
FT                   PQQQKTYSENIAYGPANKQAVPLLDKALLKDMPTTPENIQNQVAMDVTFWADYGEQLEQ
FT                   RFNAWAAR"
     atgtcgaaat ccctgaaagc ggccagcctg aagttcgcca ccctggcggc cggcctggcc        60
     tgcgcggccc aggccatggc ggtggacctg accgtggtgt ccttcggcgg ggccaacaag       120
     agcgcccaga tcaaggcgtt ctacgagccc taccagaaag ccaccggcaa caggatcgtt       180
     gccggcgaat acaacggcga gatggccaag gtcaaggcca tggtcgatac caacagcgtc       240
     tcctgggacc tggtggaagt ggagtcgccg gagctgtcgc gcggctgcga cgaaggcctg       300
     ttcgaggaac tcgacccggc gcagttcggt aagaccgagg acttcgtgcc cggcgccatc       360
     caaccgtgcg gcgtgggttt cttcgtctgg tccacggtgc tcgcctacaa cgccgacaag       420
     ctgaaaagcg cgccgaccag ttgggcggac ttctgggaca tcaagaaatt ccccggcaag       480
     cgcggcctgc gcaagggcgc caagtacacc ctcgaattcg ccctgatggc cgatggcgtg       540
     gcgccgaagg acgtctacgg cgtgctcgcc accaaggaag gccaggatcg tgccttcaag       600
     aagctcgacg agatcaagtc gagcatccag tggtgggagg cgggcgccca gccgccgcag       660
     tacctggctt ccggcgatgt ggtgatgagt tctgcctaca acggtcggat cgccgcggtg       720
     cagaaggaaa gcaacctgaa ggtggtatgg aacggcggca tctacgattt cgacgcctgg       780
     gccatcccga agggggcgaa gaaacaggaa gagaccctga agttcatcgc cttctcggtg       840
     cagccccagc agcagaagac ttactcggaa aacatcgcct acggtccggc caacaagcag       900
     gcggtgccgc tgctggacaa ggccctgctg aaggacatgc cgaccactcc ggaaaacatc       960
     cagaaccagg tggcaatgga cgtgaccttc tgggccgact acggcgaaca actggaacag      1020
     cgcttcaacg cctgggcggc caggtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page