(data stored in ACNUC7421 zone)

EMBL: CP000438.PE631

CP000438.PE631       Location/Qualifiers
FT   CDS_pept        687357..687716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_07980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL1"
FT                   /protein_id="ABJ15577.1"
FT                   /translation="MIKAIDEMLKLWAEEMHAPGSNGGGYAGGNLIAMLIASKGEVVRG
FT                   HRGSRVILDRVAEVDRLVNRLPEELKNVVVEHYLNRDSFPEQKYRHCGCSRNTFYLRLH
FT                   VAHQGIQDGLLRRVA"
     gtgatcaaag ccatcgatga aatgctcaag ctctgggccg aggaaatgca cgcgccaggc        60
     agcaacggag gcggctacgc cggcggcaac ctgatcgcca tgctgatcgc cagcaagggc       120
     gaggtggtcc gcggccaccg tggcagccgg gtgatcctcg accgtgtggc ggaggtcgat       180
     cgcctggtaa atcgcctacc cgaggaactg aagaacgtgg tggtggagca ctatctcaat       240
     cgcgacagct tccccgagca gaagtaccgc cactgcggtt gcagccgcaa caccttctat       300
     ctgcgcctgc atgtggcgca ccagggtatc caggacggcc tgctgcggcg ggtggcctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page