(data stored in ACNUC7421 zone)

EMBL: CP000438.PE633

CP000438.PE633       Location/Qualifiers
FT   CDS_pept        688551..689066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15579"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD2"
FT                   /protein_id="ABJ15579.1"
FT                   /translation="MPEQAVTLEALYAAIEQVLRERLPEAQLIGFWPGVPENTPAVSLE
FT                   IAELLPERDPGTGESALLCRLQARIMVPPGADRQAVSIACGIVRTLREQTWNLSLEPAR
FT                   FVRSAVDGSREELKSLRVWLVEWTQSLRLGDPEWAWEDQPPGSLMLGFDPQTGPGHEPD
FT                   YFAPEALA"
     atgcctgaac aggctgttac gctcgaggct ctgtacgcgg ccatcgagca ggtactgcgt        60
     gagcgtctgc cggaggcgca gttgatcggc ttctggccag gcgtgccgga aaataccccg       120
     gcggtttccc tggaaatagc cgagctactg cccgagcgcg atcccggtac cggcgagagt       180
     gccctgctgt gccgcctgca ggcgcggata atggtgccgc ctggtgccga tcgccaggcg       240
     gtatccattg cttgcggaat cgttcggaca ttgcgcgagc agacctggaa cctgtctctg       300
     gaaccggcgc gcttcgtacg ctcggccgtc gacggcagtc gcgaggagct gaagagcctg       360
     cgtgtctggc tggtcgagtg gacgcagtcg ctgcgtctcg gagacccgga gtgggcctgg       420
     gaggaccagc cgccgggcag cctgatgctg ggcttcgacc cgcagaccgg ccccggccat       480
     gagccggact acttcgctcc ggaggcgttg gcatga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page