(data stored in ACNUC7421 zone)

EMBL: CP000438.PE636

CP000438.PE636       Location/Qualifiers
FT   CDS_pept        690096..690983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08030"
FT                   /product="putative phage baseplate assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15582"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL5"
FT                   /protein_id="ABJ15582.1"
FT                   /translation="MIIDLSQLPEPEVIENLDFETIYQELLGDFREAMAGEWTAEVESD
FT                   PVLKLLQLAAYRELLLRARINDAARAVMLAYASGADLDQIGAGFNVQRLLIRPAQPEAV
FT                   PPVEAQYESDKSLRNRIQLAFEQLSVAGPRNAYIAHALGADGRVADASATSPAPCEVLI
FT                   SVLGVEGNGQAPEAVLQAVRLALNAEDVRPVADRVTVRSAGIVPYQVKAQLYLFPGPEA
FT                   ELIRAAAEASLRDYISAQRRLGRDIRRSALFATLHVEGVQRVELQEPAADVVLDETQAA
FT                   YCTGYAITLGGVDE"
     gtgatcatcg atctttccca gttgccggag ccagaggtta tcgaaaacct cgatttcgag        60
     acgatttacc aagagctgtt gggcgacttc cgcgaagcca tggctggcga atggacagcg       120
     gaggtggagt cggatccggt tctcaagctt ctgcaactgg cggcctatcg agaactgctg       180
     ctgcgggcgc ggatcaacga tgcggcgcgg gcggtgatgc tggcatacgc cagcggtgcc       240
     gatctcgacc agatcggtgc cggcttcaat gtgcagcgtt tgctgatcag gcccgctcag       300
     cccgaggcgg taccgccggt ggaggcgcag tacgagagcg acaagtcgct gcgcaatcgc       360
     atccagctcg cgttcgagca gctatccgtc gcaggaccgc ggaacgccta tatagcccat       420
     gcgctgggcg cggatggaag ggtggcggat gcctctgcga ccagtccggc gccctgcgaa       480
     gtgctgatca gcgtgctcgg ggtggaaggc aacgggcagg caccggaagc ggtgttgcag       540
     gcagtgcgcc tggcgctgaa cgcggaggac gtgcgtcctg tcgcggatcg ggtaacggtg       600
     cgctcggcag gaatcgttcc ctatcaggtc aaggcgcagc tctacctgtt tcccggcccc       660
     gaggccgagc tgatccgtgc cgccgccgag gcttcgctgc gcgactacat ttccgcccag       720
     cgccgcctgg gccgcgacat ccggcgttcg gccctgttcg ccaccctgca tgtcgaaggc       780
     gtgcagcgcg tcgaactgca ggagcctgcg gccgacgtgg tcctggatga aacccaggcg       840
     gcctattgca cggggtacgc gatcaccttg ggaggcgtcg atgagtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page