(data stored in ACNUC7421 zone)

EMBL: CP000438.PE638

CP000438.PE638       Location/Qualifiers
FT   CDS_pept        691511..693586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_08050"
FT                   /product="putative tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_08050"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15584"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD7"
FT                   /protein_id="ABJ15584.1"
FT                   /translation="MTTNTPKYGGLLTDIGAAALAAASAAGKKWQPTHMLIGDAGGAPG
FT                   DTPDPLPSVAQKSLINQRHRAQLNRLFVSDKNANTLVAEVVLPVEVGGFWIREIGLQDA
FT                   DGKFVAVSNCPPSYKAAMESGSARTQTIRVNIALSGLENVQLLIDNGIIYATQDWVKEK
FT                   VAADFKGRKILAGNGLVGGGDLSADRSIGLAPSGVTAGSYRSVTVNANGVVTQGSNPTT
FT                   LAGYAIGDAYTKADTDGKLAQKANKATTLAGYGITDALRVDGNAVSSSRLAAPRSLAAS
FT                   GDASWSVTFDGSANVSAPLSLSATGVAAGSYPKVTVDTKGRVTAGMTLAATDIPGLDAS
FT                   KLVSGVLAEQRLPVFARGLATAVSNSSDPNTATVPLMLTNHANGPVAGRYFYIQSMFYP
FT                   DQNGNASQIATSYNATSEMYVRVSYAANPSIREWLPWQRCDIGGSFTKEADGELPGGVN
FT                   LDSMVTSGWWSQSFTAQAASGANYPIVRAGLLHVYAASSNFIYQTYQAYDGESFYFRCR
FT                   HSNTWFPWRRMWHGGDFNPSDYLLKSGFYWNALPGKPATFPPSAHNHDVGQLTSGILPL
FT                   ARGGVGSNTAAGARSTIGAGVPATASLGASGWWRDNDTGLIRQWGQVTCPADADASITF
FT                   PIPFPTLCLGGYANQTSAFHPGTDASTGFRGATTTTAVIRNGYFAQAVLSWEAFGR"
     atgacgacca atactccgaa atacggtggc ctgctcaccg acataggtgc cgctgcgctg        60
     gctgcggcca gcgcagcagg caagaaatgg cagccgactc atatgctgat cggcgatgct       120
     ggcggtgcgc cgggcgacac gccggatcca ttgccttcgg tggcgcagaa gagcctgatc       180
     aaccaacgcc atcgggccca gctgaatcgg ctgttcgttt ccgacaagaa cgccaatacc       240
     ttggttgccg aggtggtgct tccagttgag gtaggtggct tctggatccg cgagatcggc       300
     ctgcaggatg ccgacggcaa gttcgtcgcg gtatccaact gcccgcccag ctacaaggct       360
     gcgatggaaa gtggcagtgc gcggacccag accattcggg tgaacatcgc gctctccggc       420
     ctggagaatg tccagctgct gatcgacaac ggcatcatct acgccactca ggactgggtg       480
     aaggaaaagg tcgctgccga tttcaagggc cgcaagatcc tggctggcaa tggcttggtc       540
     ggtgggggcg atctttctgc cgaccgcagc attggcctgg cgccttccgg cgtgacggcg       600
     ggcagctatc gctcggtcac ggtgaacgcc aacggggtgg tcacccaggg cagcaatccg       660
     accaccctgg ccggctatgc gatcggagat gcctatacca aggccgatac cgacggaaaa       720
     ctggcgcaga aagcgaacaa ggccaccacc ctggccggct atggcatcac cgatgcgctg       780
     cgagtcgatg gcaacgccgt gtcatccagc aggctggccg caccgcgcag cctggcagcc       840
     agtggcgatg cctcctggtc ggtgaccttc gacggcagtg ccaatgtttc tgcgccgctg       900
     agtctttccg ctaccggtgt ggcggcgggc agctatccga aggtgaccgt ggatacgaag       960
     ggaagggtga ctgctggaat gacgctggcg gcgacggaca ttcccgggct ggatgcgtcg      1020
     aagctggtca gcggggtgct ggccgagcag cgtttgccgg tattcgcgcg cgggttggct      1080
     actgctgtct cgaacagtag cgatccgaac accgcgaccg tgccgttgat gctgaccaat      1140
     catgcgaacg gacctgttgc cggacgatac ttctacatcc agtcgatgtt ctatccggat      1200
     cagaacggca atgcttcgca gattgcaacg agctacaacg ctacatccga gatgtatgta      1260
     cgggtgtcct acgcggccaa ccctagcatc cgggagtggt tgccctggca gcgctgcgac      1320
     attggaggtt ccttcaccaa agaggccgat ggtgaactgc ctggaggcgt caacctggat      1380
     tcgatggtga cctcagggtg gtggagccag agttttactg cccaagctgc cagtggagcc      1440
     aactacccta tagttcgggc cggcctgctt catgtgtacg ccgcgagtag caatttcatc      1500
     tatcagacgt atcaagccta cgatggtgag agtttctatt tccggtgccg gcattcaaat      1560
     acctggtttc cctggcgtcg catgtggcat ggcggagact tcaaccccag tgactatctg      1620
     ttgaagtcgg ggttctattg gaatgcgtta ccgggaaaac ctgccacttt tccaccatct      1680
     gcacataacc atgacgtcgg acagcttact tcgggcattc tccccctggc acgtggcggc      1740
     gtcggttcga atacggcagc gggagcacgt agcactatcg gagcaggggt tcctgcgact      1800
     gcttcccttg gggcgagcgg atggtggcgg gacaatgaca ctggcctcat taggcaatgg      1860
     gggcaggtca cttgccccgc cgatgccgat gcttcgatta cgttcccgat tcctttccct      1920
     acgctatgcc tcggcggata tgcgaatcag acgagtgctt tccatccggg aacggatgcc      1980
     agtacaggtt tccgtggagc gactaccact accgcggtga ttcgcaatgg ctactttgct      2040
     caggcggttc tttcatggga ggcatttgga cgatga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page