(data stored in ACNUC7421 zone)

EMBL: CP000438.PE65

CP000438.PE65        Location/Qualifiers
FT   CDS_pept        complement(74060..75043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15021"
FT                   /db_xref="GOA:A0A0H2ZJ05"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ05"
FT                   /protein_id="ABJ15021.1"
FT                   /translation="MTDNPFATPTAPVQPPAREVPATTQPYAFIAVLALVTCLSFAVSL
FT                   GIQWYNDIGEIRQRFSEHLQLMAPHWFTGLVFYAAANLLVLHAYREKRQLVEFRPLALL
FT                   LIGYGLLNLVCGMLAGIGLAPLTLPFYQWVTAQSSYGVWLMAFNEAMSWVYLLLGSLLP
FT                   LGLVLLGSRVNSPRLAEGEEARVAAWQVALGAALCFATLCFKLMQFLPYALLRYDEPWL
FT                   YGLYLSGVALPAALLFGAVCTRLPARLQRFAAGRALLLAVVAMLLWSVALLAVGGGLAL
FT                   LMILGLAPAGIGYTLLVALLGVGLLALLWPIGRLATRWCYADQLAA"
     atgaccgaca atcccttcgc cacccccacc gccccggtgc agccgccggc cagagaggtg        60
     cccgccacca cccagcccta tgcgttcatc gcggtgctgg cgctggtcac ctgcctgtcc       120
     ttcgccgtga gcctgggcat ccagtggtac aacgacatcg gcgagatccg ccagcgtttc       180
     tccgagcacc tgcaactgat ggcgccgcac tggttcaccg gcctggtgtt ctacgcggcg       240
     gccaacctgc tggtgctgca tgcctaccgc gagaagcggc agctcgtcga gttccgcccg       300
     ctggcgctgc tgctgatcgg ctacggccta ctcaacctgg tctgcggcat gctcgccggg       360
     atcggcctgg caccgctgac gctgccgttc taccagtggg tgacggcgca atccagctac       420
     ggcgtctggc tgatggcgtt caacgaagcg atgagctggg tctacctgct cctgggcagc       480
     ctgctgccgt tggggctggt gctgctcggc agccgggtga actcgccgcg cctggccgaa       540
     ggggaagaag cccgcgtcgc tgcctggcag gtcgccctgg gcgccgcgct gtgtttcgcc       600
     acgctgtgct tcaagctgat gcagttcctt ccctacgccc tgctgcgcta cgacgagcct       660
     tggctatacg gcctgtacct gagcggcgtg gcgttgcccg cggcgctgct cttcggtgcc       720
     gtctgcacgc gcctgccggc gcgcctgcag cgcttcgccg ccggccgcgc gctgctgctc       780
     gcggtggtcg ccatgctgct ctggagcgtg gcgctgctgg cggtcggcgg ggggctggcg       840
     ctgctgatga tcctcggcct ggcgcccgct ggcatcggct atacgctgct ggtggcgctg       900
     ctcggcgtcg gcctgttggc gctgctctgg ccgatcggcc ggctggccac gcgctggtgc       960
     tacgccgacc agctcgccgc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page