(data stored in ACNUC7421 zone)

EMBL: CP000438.PE69

CP000438.PE69        Location/Qualifiers
FT   CDS_pept        78396..78671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00800"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15025"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJQ0"
FT                   /protein_id="ABJ15025.1"
FT                   /translation="MSPAITRKRFIAGAVCPACSEQDKIQMWEEDGVPHRECVACGYAD
FT                   TLNAQGQSIPKELGTRVNQNAPKPANPKVQSVQFFPNPKLKKKPDA"
     atgagcccgg cgatcaccag gaagcgcttc atcgccgggg cggtctgccc ggcgtgcagc        60
     gaacaggaca agatccagat gtgggaagag gacggcgtgc cgcaccgcga atgcgtggcc       120
     tgcggctacg ccgacacgct caacgcccag ggccagtcga tcccgaagga gctgggtacg       180
     cgggtcaacc agaacgcgcc gaagccggcc aacccgaagg tgcagtcggt gcagttcttc       240
     cccaatccca agctgaagaa gaagcccgac gcctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page