(data stored in ACNUC7421 zone)

EMBL: CP000438.PE7

CP000438.PE7         Location/Qualifiers
FT   CDS_pept        8671..10377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14963"
FT                   /db_xref="GOA:A0A0H2ZJK8"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJK8"
FT                   /protein_id="ABJ14963.1"
FT                   /translation="MKRLKKTLHLSSLSLVSLALSSAALAAAPVMLDQGKEWTESHRQD
FT                   FYSRDQGSQVMPLPWLKALRQPDGTPFLADSLARYGYLPNPKAPAEGLPVGFTVAGTGA
FT                   RQMVGMTCSACHTRQIEVKGTAYRIDGGPAIVDFQAFLADLDRAVGPLTSDDAAFDAFA
FT                   KQILGANPPPGARDALLAAVKEWYEPYHTLIERALPKDTWGPARLDAVSMIFNRLTGLD
FT                   IGTAPPYLIPDNIKAADAPVRYPFLWNAARQNKTQWPGFAANGNDLLGLARNVGEVYGV
FT                   FATFHPQKSKFHLLGMDYLKVNSANFHGLGKLEELIKKIGPPKWPWAVDKHLARKGALI
FT                   FARKTDEGGCVECHGIRIKDLVLWDTPLRDVGSDSRQHAILDGQVQTGVMEGARMPFGQ
FT                   PLKATDEAFDVLAVAVAGSILQHFVPILGEKHDAKAAAVKPESVMTDETRQLLTAFQKP
FT                   VRTQADPYPYESRVLQGIWAAAPYLHNGSVPTLEELLKPAAERVESFPVGSAYDVDKVG
FT                   LAAQQTQFGSYVLKTTGCEQRASGNSRCGHEYGTSLSAEEKRALLEYLKVL"
     gtgaaacgcc tgaaaaagac actgcacctt tcaagcttgt ccctcgtttc cctggctctt        60
     tcttccgccg ccctggcggc cgctccggtc atgctcgacc agggcaagga atggaccgaa       120
     agccaccgcc aggacttcta cagccgcgac cagggctcgc aggtgatgcc cctgccctgg       180
     ctcaaggcgt tgcgacagcc ggatggaacg cctttcctcg ccgacagcct ggcccgctac       240
     ggctatttgc ccaatcccaa ggcgcccgcg gaaggcctgc cggtgggctt caccgtagcc       300
     ggcacgggcg cccggcagat ggtcggcatg acctgttcgg cctgccatac ccggcagatc       360
     gaggtgaagg gcacggccta tcggatcgac ggcggtccgg cgatcgtcga cttccaggca       420
     ttcctcgccg acctcgatcg ggccgtggga ccgctgacca gcgatgacgc cgccttcgac       480
     gccttcgcca agcagatcct cggggccaat ccgcctcccg gtgcgcgcga cgccctgctc       540
     gcggcggtga aggaatggta cgagccctat cacacgctga tcgagcgcgc gctgcccaag       600
     gacacctggg gaccggcgcg gctggacgcg gtatcgatga tcttcaaccg ccttaccggg       660
     ctggatatcg gcaccgcgcc gccctatctg attcccgaca acatcaaggc ggcggatgcg       720
     ccggtgcgct acccgttcct gtggaacgcg gcgcggcaga acaagaccca gtggcccggc       780
     ttcgccgcca acggcaacga cctgctcggc ctggcgcgca atgtcggcga ggtctacggg       840
     gtgttcgcca ccttccaccc gcagaagagc aagttccacc tgctgggcat ggactacctg       900
     aaggtcaact cggccaactt ccacgggttg ggcaagctgg aggagctgat caagaagatc       960
     ggcccgccga agtggccctg ggcggtggac aagcacctgg ccaggaaagg cgcgctgatc      1020
     ttcgcccgca agaccgacga gggtggctgc gtggagtgcc acggcatccg gatcaaggac      1080
     ctggtgcttt gggacactcc gctgagggac gtcggcagcg acagccgcca gcacgccatc      1140
     ctcgatggcc aggtgcagac cggcgtgatg gagggcgcgc ggatgccgtt cggccagccg      1200
     ctgaaggcga ccgacgaagc cttcgatgta ctcgccgtag cggtggccgg ttcgatcctg      1260
     cagcacttcg tgccgatcct cggtgagaag cacgatgcca aggcggcggc ggtcaagccg      1320
     gaaagcgtga tgaccgacga aacccggcaa ctgctgaccg ccttccagaa gccggtgcgt      1380
     acccaggccg acccctaccc ctacgagtcg cgggtcctgc aggggatctg ggcggcggcg      1440
     ccgtacctgc acaacggctc ggtgccgacc ctggaagagt tgctgaagcc ggccgcggag      1500
     cgggtggaat ccttcccggt gggctcggcc tacgacgtgg acaaggtcgg cctcgccgcc      1560
     cagcagaccc aattcggcag ctatgtgctg aagaccaccg gctgcgagca gcgtgcttcc      1620
     ggcaacagcc gctgcggcca tgagtacggc accagcctgt cggccgagga gaagcgcgcg      1680
     ctgctggagt atctgaaggt cctgtag                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page