(data stored in ACNUC7421 zone)

EMBL: CP000438.PE71

CP000438.PE71        Location/Qualifiers
FT   CDS_pept        complement(80049..80963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00820"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15027"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJZ5"
FT                   /protein_id="ABJ15027.1"
FT                   /translation="MSQPSENRLITSARYALCLLTASGVLLSGCASSGVGSVAQTTRAE
FT                   YYPSCYEPVSHLRSTDNAVRNSAITGAITGGLLGGLAGGLASDENRGRNAALAAAGGAL
FT                   AGGAAGYYMEKQKQISDDRARIGSYATDVDRSTVEINRSVAYAKSAQSCYQSQFKALLD
FT                   GRKNKSINEAEGRKRLAEIVSGLQETNALLVAANGRAGENINNYTQAYEKDLQQVGVPR
FT                   TEVTKVAEAENRASTTKGGSKPKTGSNPKVPKEAVATEQTIRKAQDAQSEGNKVASRGQ
FT                   GMIQEVCNSPDMGDWAPPSCAKA"
     atgagccaac ccagcgaaaa ccgtttgatc acctcggcgc gctacgcgct ctgcctgttg        60
     accgccagcg gcgtgctgct cagcggctgc gccagcagcg gcgtcggctc ggtcgcccag       120
     accacccgcg cggaatacta cccgtcctgc tacgagccgg tgtcgcacct gcgcagcacc       180
     gataacgcgg tgcgcaactc ggccatcacc ggcgccatca ccggcggcct cctgggcggc       240
     ctggccggcg gcctggccag cgacgagaac cgcggccgca atgccgccct cgctgccgca       300
     ggcggcgccc tggccggcgg cgcggcgggc tactacatgg agaagcagaa gcagatcagc       360
     gacgaccgcg cgcgcatcgg ctcctacgct accgacgtcg accgcagcac cgtcgagatc       420
     aaccgtagcg tggcctacgc caagtcggcg caaagctgct accagagcca gttcaaggcc       480
     ctgctcgacg gccgcaagaa caagtcgatc aacgaagccg aagggcgcaa gcgcctggcc       540
     gagatcgtca gcggcctgca ggagaccaac gccctgctgg tcgccgccaa cggccgtgcc       600
     ggcgagaaca tcaacaacta cacccaggcc tacgagaaag acctgcagca ggtcggcgta       660
     ccgcgcaccg aagtgaccaa ggtcgccgag gccgagaacc gcgccagcac tacgaaaggc       720
     ggcagcaagc ccaagaccgg cagcaatccc aaggtgccga aggaggcggt cgccaccgag       780
     cagaccatcc gcaaggccca ggacgcgcaa agcgaaggca acaaggtggc ctcccggggc       840
     cagggcatga tccaggaagt ctgcaacagc ccggacatgg gcgactgggc accgccgagc       900
     tgcgccaagg cctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page