(data stored in ACNUC7421 zone)

EMBL: CP000438.PE72

CP000438.PE72        Location/Qualifiers
FT   CDS_pept        complement(81025..82737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15028"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK19"
FT                   /protein_id="ABJ15028.1"
FT                   /translation="MFEKAILPLALGACLAFAAPAWAEGDSPDNPKPLADDVALPLPCG
FT                   GEMVFRHVYVLAEGALDDREVNLGYAFNEGEAGYQQSFISGYRRDYVNGQFSLADLAPA
FT                   WQQKLSASLPKPAAGTPLKPMLYFIGKYEVTARQYAAVMSQAAALSGQGEAPACDVPGG
FT                   MAARLPKVDLSRFDAERFGAVYSAWLLKNHPDLLPVSGRGKNPEDGGIGFVRLPTEVEW
FT                   EFAARGGQAVSRQELEGRLFPRKVEGSDQEGPLGDWAVYNQVAGGTGQAARLLPVGMKR
FT                   PNPLGLFDVIGNAAEMVQESFQLVHAGRRQGTYGGFVVKGGNYLEGEMTLFTGMRREYP
FT                   LFAADGSEQRNETTGFRVAIGALSAPRSRYPELFAQWQKEGRLAALTDAIDDAQDPTKQ
FT                   LDGIIAATRDPQMQAQLAQINEELKRNVSLIARQREEAAGNLIQSAALVAETINNYNIR
FT                   LTNLKKDREKAVAARDQATAQLYAGAIANGRSALDGALAIYIDNLATGTRYTDAVIQAQ
FT                   FQRIQEELNRNPVLGKSLVKRATLFVKHVGDYRQQHRAEPEAVLKELLASSGR"
     atgtttgaga aagccattct tccgctcgcc ctcggcgcct gcctggcatt tgccgcgccg        60
     gcctgggccg aaggcgactc gccggacaat cccaagccgc tggccgacga cgtcgccctg       120
     ccgctgccgt gtggcggcga gatggtcttc cggcatgtct acgtactcgc cgaaggcgcc       180
     ctcgacgatc gcgaggtcaa cctcggctac gccttcaacg aaggcgaggc gggctaccag       240
     cagtcgttca tctccggcta ccggcgcgac tacgtgaacg gccagttcag cctcgccgac       300
     ctggcaccgg cctggcagca gaagctctcc gccagcctgc cgaagcccgc cgccggcacc       360
     ccgctgaagc cgatgctgta cttcatcggc aagtacgagg tgaccgcccg ccagtacgcc       420
     gcagtgatga gccaggcggc cgcgctctcc ggccagggcg aagcgccggc ctgcgacgtg       480
     ccgggcggga tggccgcgcg gctgcccaag gtcgacctct cgcgcttcga cgccgaacgc       540
     ttcggcgcgg tgtacagcgc ctggctgctg aagaaccacc cggatctgct gccggtcagc       600
     ggccgcggca agaatcccga ggacggcggc atcggcttcg tccgcctgcc caccgaggtc       660
     gagtgggagt tcgccgcgcg cggcggccag gcggtcagcc gccaggaact ggaaggccgg       720
     ctgttcccgc gcaaggtcga gggcagcgac caggaaggcc cgctgggcga ctgggcggtg       780
     tacaaccagg tcgccggcgg taccggccag gccgcgcgac tgttgccggt agggatgaag       840
     cggccgaacc cgctgggcct gttcgacgtg atcggcaatg ccgcggagat ggtccaggag       900
     tccttccaac tggtccacgc cggtcgccgg cagggcacat atggcggttt cgtggtgaag       960
     ggcgggaact atctcgaagg cgagatgact ctattcaccg ggatgcgccg cgaatacccg      1020
     ctgttcgccg ccgacggcag cgaacagcgc aacgagacca ccggtttccg cgtcgccatc      1080
     ggcgcgctgt ccgcgccgcg ctcgcgctat cccgagctgt tcgcccaatg gcagaaggaa      1140
     ggccgactag cggcattgac cgatgccatc gatgacgctc aagatcccac caagcaattg      1200
     gacggaatca ttgccgccac ccgcgacccg cagatgcagg cgcagttggc ccagataaac      1260
     gaggaactca agcgtaacgt ttcgttgatc gctcggcagc gcgaagaggc cgccggaaac      1320
     ctgatacagt cggcggcact ggtcgccgag acgatcaaca actacaacat acgcctgacc      1380
     aacctcaaga aggacaggga gaaagccgtg gcagccaggg atcaggcgac cgcccagctc      1440
     tatgccggcg ccatcgccaa cgggcgcagc gccctcgatg gcgcattggc catctacatc      1500
     gacaacctcg ccaccggcac ccgttacacc gacgcggtga tccaggcgca gttccagcgc      1560
     atccaggaag aactcaatcg caacccggtt ctgggcaaga gcctggtcaa gcgcgcgacc      1620
     ctgttcgtca aacacgtcgg agattatcgc cagcagcacc gggccgagcc ggaggcggta      1680
     ttgaaggaat tgctcgcgtc cagcgggcgt tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page