(data stored in ACNUC7421 zone)

EMBL: CP000438.PE77

CP000438.PE77        Location/Qualifiers
FT   CDS_pept        complement(88489..89169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15032"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK01"
FT                   /protein_id="ABJ15032.1"
FT                   /translation="MNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLASGMRASQDELG
FT                   AAWLDAYLTSPLWRFAIAPGLLGGEAVAGVVMPSIDRVGRYFPLTVACLLPANADLGGL
FT                   VGGDDGWFEQVESLLLSTLEPEAEVEAFEQAVAQLPAPPCGPRIEQSLISGNLLRSEAV
FT                   TPAQRLAALAQHACDGASHWWGRGSARISAGLMRYQGLPPAPAFGRFLTGEGEVIPLFP
FT                   GIPG"
     ttgaacagcg tcggtttcta cggcaagctg gccggccgcg gcgatttcgt cagccgcggc        60
     ctgccgaaca ccttcgtcga accctgggac gcctggctgg ccagcggcat gcgcgccagc       120
     caggacgaac tcggcgcggc ctggctcgac gcctacctga ccagcccgct gtggcgcttc       180
     gccatcgccc ccggcctgct cggcggcgaa gcggtggccg gggtggtgat gccgagcatc       240
     gaccgggtcg gtcgctattt cccgctgacc gtcgcctgcc tgctgccggc gaacgccgac       300
     ctcggcgggc tggtcggcgg cgacgacggc tggttcgagc aggtcgagag cctgctgctc       360
     tccaccctcg aaccggaggc cgaggtcgag gccttcgagc aggcggtggc gcagctcccg       420
     gcccctccct gcggaccgcg catcgaacaa tcgctgatca gcggcaacct gctgcgcagc       480
     gaagcggtga ccccggcgca gcgcctcgcc gcgctggccc agcatgcctg cgacggcgcc       540
     agccactggt ggggacgcgg ctcggcacgg atctccgccg gcctgatgcg ctaccagggc       600
     ctgccgccgg cgccggcgtt cggacgattc ctcaccggag agggcgaggt gatcccgctc       660
     tttcccggca tacccggtta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page