(data stored in ACNUC7421 zone)

EMBL: CP000438.PE78

CP000438.PE78        Location/Qualifiers
FT   CDS_pept        complement(89166..92474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15033"
FT                   /db_xref="GOA:A0A0H2ZK24"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK24"
FT                   /protein_id="ABJ15033.1"
FT                   /translation="MQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSER
FT                   RNLYELPWYVIIGPPGSGKTTALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAV
FT                   LLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRKRRPIDGAFIAISLSDLLLGSDAERA
FT                   AHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDSLNREERAQVWGMTFALD
FT                   DGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAALRECLGE
FT                   FLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRS
FT                   YFIERLFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQS
FT                   YIAAVDQRVDPLARGIESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLG
FT                   EESASVYRKLLIAVFAPRLVTRIEEQLRSGGSSDFLYEGLKAYLMLGSPDHYDADFIKA
FT                   WISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSARLDQDLVEDLRRQLQQLPVAQR
FT                   VYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTYRGYREVFLTA
FT                   SLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNV
FT                   TQAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSL
FT                   VGQEEEEGAREQPQQADSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVS
FT                   AMAGASGDSLLGDAKNQVAAAASRVALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQL
FT                   NAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDFGHFFGAGGVMDSYFRQYLQPYVDT
FT                   SASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAVRFELKPVTMDAAIS
FT                   QFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAWFR
FT                   LLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL"
     atgcagagtc tcgccgaggt cagcgcgccg gacgccgcca gcgtcgccac cgccgaagag        60
     ctggcgaccc tcaagcaacg catggacgag gccctggccc tgctcaagcg ggccaagctg       120
     ggcggcagcg agcggcgcaa cctgtacgag ttgccctggt acgtgatcat cggcccgccc       180
     ggttcgggca agaccaccgc gctgatgaac tccggcctgg acttcccgct cgccgcacag       240
     atgggcgccg gggcgatccg cggggtcggc ggcacgcgca actgcgactg gtggttcacc       300
     gacgaagcgg tgctgctgga caccgccggc cgctatacca cccaggacag ccacgcccag       360
     gtggacaagg ccgcctggct gggcttcctc gacctgctca agacccagcg caagcgccgc       420
     cccatcgatg gcgcgttcat cgccatcagc ctttccgacc tgctgctggg cagcgacgcc       480
     gagcgcgccg cccatgccca ggcgatccgc gcgcgcatcc aggagctgta ccagcagctc       540
     ggggtgcgct tcccgatcta cgtgatgctg accaagttcg acctggtgcc gggcttcatg       600
     gagttcttcg acagcctgaa ccgcgaggaa cgcgcgcagg tctgggggat gaccttcgcc       660
     ctcgacgacg gcaagagcgc ggaaggcccg ctggcggtgt tcgacagcga attcgccctg       720
     ctcgaacagc gtctcaccgc gcgcctggtg gaacgcctgc agcaggagcg cgacccggcg       780
     cggcgcgacc tggtctacgg cttcccgcag caattcgccg ccctgcgcga atgcctcggc       840
     gagttcctca acggcgtgtt caagcccaac ccctacgagg aacgcccgct gttgcgcggc       900
     ctgtacttca ccagcggaac ccaggaaggc agtccgatcg accgcctgat cggcagcatg       960
     gcgcagtcga tgaacctcga ccgccagcac ctggcgcggc agaccggaac cgggcgcagc      1020
     tacttcatcg agcggctgtt ccgcgaagtg gcgttcggcg aacgcggcct ggtcggcacc      1080
     aacccgaagg tcgagcgccg ccgcaaatgg ctgaccatcg gcgcgctgag cgccaccgcg      1140
     ctggtggtgc tggcggtgac ggcggtatgg atcgccagct accgcgccaa ccagagctac      1200
     atcgccgcgg tcgaccagcg cgtcgacccg ctggcgcgcg gcatcgagtc gctgagcccg      1260
     gcccagcgcg acgtcctggc cgtactgcca cagctcaacg cggtgcagaa tctcgccggc      1320
     gacgcgccaa gctgggccga aggctacggg ctgtaccagg gcgacatgct cggcgaggag      1380
     tccgccagcg tctaccgcaa gctgctgatc gcggtgttcg ccccgcgcct ggtgacccgc      1440
     atcgaggaac agttgcgctc cggcggcagc agcgatttcc tctacgaggg cctgaaggcc      1500
     tacctgatgc tcggcagccc ggaccattac gacgccgact tcatcaaggc ctggatcagc      1560
     ctcgactggg aacgcaacct gccgcgcgac ctctcgccgg aacagcgcca ggcgctgcac      1620
     gcgcacctcg acgcgttgct cgaacgacgg ccgccgtcgg cgcgcctgga ccaggacctg      1680
     gtcgaggacc tgcgccgcca gttgcagcaa ctaccggtgg cgcagcgggt ctacgaccgg      1740
     gtcaagcggc agaggctgcc caaggacgtg cccgacttcc gcatcagcga cgccgccggc      1800
     cgcgacgcac cgctggtgtt cgcgcgcaag agcggcaagc cgctcaccga cccgctcagc      1860
     ggcttcttca cctaccgcgg ctatcgcgag gtgttcctca ccgccagcct cagccaggcc      1920
     ggcaccatcg ccgaggaaca gtgggtgctc gggcgcgacc tgaacgatgc cggcgatgcc      1980
     gccaacctgg ccctcgacgt gcgtcgcctg tacttccagg actacctgcg gcaatgggac      2040
     gacctgctcg ccgacctcac cgtggtgccg atcaccaacg tcacccaggc cgccgacgtg      2100
     ctgcgcattc tctccgggcc gacctcgccg ttccgcaagc tgctcgaggc ggtggcccgc      2160
     gagaccgacc tgcagaaggg cgaccggctg gtcgccgcgc aagtgaagaa ggccgccgac      2220
     ggcaccgtgg acaagctcaa gcagcgcctc ggctcgctgg tcggccagga ggaggaggaa      2280
     ggcgcccgcg aacagccgca gcaggccgac agcgacccga tcagcgccca cttcgccgaa      2340
     ctcaacagcc tggtcagcaa gggcgagggc ggcaacgagc cggcgccgat cgacagcctg      2400
     ctggaggaca tgaacgcgct ctacgtacag gtcagcgcca tggccggagc cagcggcgac      2460
     tcgctgctcg gcgacgccaa gaaccaggtg gccgccgccg cctcgcgcgt ggccctcagc      2520
     gccgagcgcc agccgccggt ggtccagggc ctggtgaaga acgtggtcaa ctccaccacc      2580
     agcagcatga tgggcagcgt gcgcaaccag ctcaacgcgg cctggatcag cgacgtggtc      2640
     agcgtctacc ggcagtccct ggccgggcgc tacccgatcg ccgccggcag ctcgcgcgac      2700
     gccaccctgg aagacttcgg ccacttcttc ggtgccggtg gggtgatgga cagctacttc      2760
     cgccagtacc tgcaacccta cgtcgacacc tccgccagca cctggcgctg gcagcccggc      2820
     gcggcgcaga agctcggcat caaccccggc gtgctgcaca ccttccagcg cgcggcggcg      2880
     atccgcgacg ccttcttccg ctccggcggc atgcagccgg cggtgcgctt cgaactcaag      2940
     ccggtgacca tggacgcggc gatcagccag ttcatcctcg acctcgacgg ccagcagctg      3000
     acctacgacc acggccccgc ccgcccggtg gcgatgcagt ggccgagcgc caacggcctc      3060
     ggcgtggtcc gcctgacggt gacgccgccg cccagcagcg gccgttccgg cctgaccctg      3120
     gagggcccct gggcctggtt ccgcctgctc gaccagtcgg acctggaacg cggcaactcg      3180
     ccggaccgct tcaccctgcg gctgcgcatc gacggctcca gcatcgcctg cgagctgcgc      3240
     gccagcagcg ccttcaaccc cttcaagagc cgggtcgtgt ccggcttcag cctcccggag      3300
     cgcctttga                                                              3309
//

If you have problems or comments...

PBIL Back to PBIL home page