(data stored in ACNUC7421 zone)

EMBL: CP000438.PE79

CP000438.PE79        Location/Qualifiers
FT   CDS_pept        complement(92696..94045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15641"
FT                   /db_xref="GOA:A0A0H2ZKR2"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR2"
FT                   /protein_id="ABJ15641.1"
FT                   /translation="MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGD
FT                   PYTPPPMASLAPLSGRGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQ
FT                   FEEKARQAGVAPDEVMLARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEK
FT                   VFQLLEHCLQNPHQRLHLLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTR
FT                   GEYEHELSPHWRGLSVMRDRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKR
FT                   IHAIGEIPVQAIDRPAVQPRVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELF
FT                   ASASASVRDEFQPLLLRIADALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEV
FT                   ADLLGATTGDAGRFTAEGRSDTEPVATNASAEGRARNRRVEITVFAEGAQ"
     atgcctccca tcgacgatcc cttcggcacc ccggccggcg gcggcaacgg aagcccgccc        60
     gacgaccgca ccatgatcat gccgcgtccc ggcggccgcg ccccggaacc ggccggcggc       120
     ccccgcggcg gcgatcccta cacgccgccg ccgatggcca gcctggcgcc gctgagcggc       180
     cgcggcgacg gcctcaaccc gctggagcag gccgccggcc cactgctggc gatgctcacc       240
     cgcctgcgca acaccatcgc ccatccggcg ccggccagcc tgcgcgcgca actgctcggc       300
     tacctgcgcc agttcgagga gaaggcacgc caggccggcg tggcgccgga cgaagtgatg       360
     ctggcgcgct acgtgctctg caccgccctc gacgaagcgg tgctcagcac gccgtggggc       420
     agcaccagcg actggggcaa gcagagcctg ctgatcaccc tgcacaacga ggcctggggc       480
     ggcgagaagg tcttccagtt gctcgaacac tgcctgcaga acccgcacca gcgcctgcac       540
     ctgctggagc tgctgtacct gtgcaccagc ctcggcttcg aaggccgcta ccgggtcatg       600
     cacgacggcc gcagccaact ggaggcgctg cgcgagcgca ccgcggcggt gatccgcagc       660
     acccgcggcg agtacgagca cgaactgtcg ccgcactggc gcggcctcag cgtgatgcgc       720
     gaccgccttt cgcaatacct gccgccgtgg gtcggtatcg ccatcggcct ggccttgctg       780
     ctggccttgc tgttcggcct gcggatgaag ctggccgccg acgccgagcc ggtgttcaag       840
     cgcatccacg ccatcggcga gatcccggtg caggccatcg accgcccagc ggtgcagccg       900
     cgggtgatcg aacggccacg cctggcgcgc ttcctcgcag acgacatcaa ggcccagcgg       960
     gtggcggtgg aggacgccgt cgaccgctcg gtggtgacca tccgcggcga cgagctgttc      1020
     gccagcgcca gcgccagcgt gcgcgacgag ttccagccgc tgctgctgcg catcgccgac      1080
     gccctgcgca aggtcaaggg ccaggtgctg gtcaccggcc atagcgacaa ccggccgatc      1140
     gccacgctgc gctacccgtc caactggaaa ctgtcccagg cccgcgccca ggaggtcgcc      1200
     gacctgctcg gcgcgaccac cggcgacgcc ggccgcttca ccgccgaagg gcgcagcgac      1260
     accgagccgg tggcgaccaa cgccagcgcc gaaggccgcg cacgcaaccg ccgggtggaa      1320
     atcaccgtat tcgcggaggg cgcgcaatga                                       1350
//

If you have problems or comments...

PBIL Back to PBIL home page