(data stored in ACNUC7421 zone)

EMBL: CP000438.PE80

CP000438.PE80        Location/Qualifiers
FT   CDS_pept        complement(94052..95386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15034"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK83"
FT                   /protein_id="ABJ15034.1"
FT                   /translation="MSWNNRVVWSEGMFLRPQHFQQHDRYLETLVDGRCRSLLAGGWGF
FT                   SELKLDDALLTQGKLAIVSARGVLPDGTPFNIPADDPAPAPLNVEESLRDGIVYLGLPL
FT                   KRVGTRDTVEEGEALGGARYVSQVQEVRDDNAAFESRAPVALGSQAFRLLTERDGLGEY
FT                   AAVGVARVREKRADQALSLDEDYLPPVLDIAAAPPLASFAKELLGLLHQRGEALAGRVV
FT                   ASSAGGASEIADFLLLQLVNRAEALTGHLSRVRPLHPQELYRELVALAGEFCTFTASQR
FT                   RPEEYPVYNHDDLAASFAPVMLALRQALATVIDAKAIAIPIVEKAYGVHVAMLSDRSLI
FT                   DNASFVLVVRADVPGESLRGHFPQQAKVGSVEHIRDLVNLQLPGIGLLPMPVAPRQIPY
FT                   HAGSTYFELDRGSAHWKQLTHSGGFAFHIAGQFPGLNLAFWAIRG"
     atgtcctgga ataaccgcgt ggtgtggtcc gaaggcatgt tcctgcggcc acagcatttc        60
     cagcagcacg accgctacct ggaaaccctg gtggatggcc gctgccgctc gctcctggcg       120
     ggcggctggg gcttttccga gctgaagctg gacgatgccc tgctgaccca gggcaagctg       180
     gccatcgtca gcgcccgcgg cgtgctgccg gatggcacgc cgttcaacat ccccgccgac       240
     gatccggcgc cggcgccgct gaatgtcgag gaaagcctgc gcgatggcat cgtctacctc       300
     ggcctgccgc tgaagcgcgt cggcacccgc gacacggtag aggagggcga ggccctcggc       360
     ggcgcccgct acgtcagcca ggtgcaggaa gtgcgcgacg acaatgccgc cttcgagagc       420
     cgcgcgccgg tggccctggg cagccaggcg ttccgcctgc tgaccgagcg cgacggcctc       480
     ggcgaatacg ccgcggtggg cgtcgcgcgg gtccgcgaga agcgcgcgga ccaggccctg       540
     agcctggacg aggactacct gccgccggta ctcgacattg ccgccgcgcc gcccctggcg       600
     tccttcgcca aggagctgct gggcctgctc caccagcgcg gcgaagccct cgccgggcgg       660
     gtggtggcct ccagcgccgg gggcgcctcg gaaatcgccg acttcctgct gctgcaactg       720
     gtcaaccgcg ccgaggccct caccggtcac ctgtcccgcg tgcgcccgct gcacccgcag       780
     gagctgtacc gcgaactggt ggccctggcc ggcgagttct gcaccttcac cgccagccag       840
     cggcgtcccg aggagtaccc ggtgtacaac cacgacgacc tggccgccag cttcgccccg       900
     gtgatgctcg ccctgcgcca ggcgctggcg acggtgatcg acgccaaggc gatcgccatc       960
     ccgatcgtcg agaaggccta cggcgtgcac gtcgcgatgc tcagcgaccg cagcctgatc      1020
     gacaacgcca gcttcgtcct ggtggtgcgc gccgacgtcc ccggcgagag cctgcgcggg      1080
     cacttcccgc agcaggccaa ggtcggctcg gtggagcaca tccgcgacct ggtcaacctg      1140
     caactgccgg gtatcggcct gctgccgatg ccggtggcgc cgcggcagat cccctaccac      1200
     gccggctcca cctatttcga actggaccgc ggcagcgcgc attggaagca gctgacgcac      1260
     tccggcggct tcgccttcca catcgccggc cagttccccg ggctgaacct ggccttctgg      1320
     gccattcgag gataa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page