(data stored in ACNUC7421 zone)

EMBL: CP000438.PE82

CP000438.PE82        Location/Qualifiers
FT   CDS_pept        complement(95911..96453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00970"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15036"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ19"
FT                   /protein_id="ABJ15036.1"
FT                   /translation="MKVDPAGAEAQMEAIRRTYRCLVEGLVDVLRTLDNLKGEFRMAQT
FT                   MIQPVQNNPLKFAPNVDEAMLLLLRRDNQAFMAPDRAVADSFEDLKAHQLAVMAGVQAA
FT                   IRHLLARFEPAALEARFGKPAGLSGLLPGARQAQNWDSFTELYAKILREAEDDFQELFG
FT                   REFSRAYEEHSARLRRS"
     gtgaaggtcg acccggccgg cgccgaagcg cagatggaag ccatccgacg cacctatcgc        60
     tgtctggtgg aaggactggt ggacgtgctg cgcacgctgg acaacctgaa gggcgagttc       120
     cgcatggcgc agaccatgat ccagcctgtg cagaacaacc cgctgaagtt cgcgccgaac       180
     gtcgacgaag ccatgctgct cctgctgcgc cgcgacaacc aggcgttcat ggcgccggat       240
     cgcgcggtgg ccgacagctt cgaagacctc aaggcgcacc agttggcggt gatggccggc       300
     gtgcaggccg ccatccgcca cctgctggcg cgcttcgaac cggccgcgct ggaagcccgc       360
     ttcggcaagc cggccgggct ttccggcctg ctgccggggg cccgccaggc acagaactgg       420
     gacagtttca ccgagctgta cgcgaagatc ctgcgcgagg cggaggacga cttccaggag       480
     cttttcggcc gcgaattcag ccgcgcctac gaggaacaca gcgctcgact acggcgttcc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page