(data stored in ACNUC7421 zone)

EMBL: CP000438.PE83

CP000438.PE83        Location/Qualifiers
FT   CDS_pept        complement(96450..97409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00980"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15037"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK07"
FT                   /protein_id="ABJ15037.1"
FT                   /translation="MPLRLTITSYHKLTPGQCSEKVLDQGQLTIGRGPDNDWVLPDPER
FT                   LVSSRHCTILNRDGVYYLTDTSTNGVLLVNAGHRLRRGNSEPLQDGETVRLGEYDILVQ
FT                   LGHDIALPGSGNPQTDPFTSFDALMSRQAAGSAPAFAEPAPTPHPAVTAHFQGGSPLDT
FT                   KPDLFDFLTPPPPGAAPRPDHVPAEQHDFRPPEPVIPLPPATTPAPPPAGGAPLIPADW
FT                   DPFAELLGNTPAPSATPVVQPQPAAEPTPLAMPFADPGITQQPQPQPQPQPQPQPQPQP
FT                   QPQPQPASVAAPTPPASAAATAGGDLLQAFLRGAGMTQ"
     atgccgctgc gattgaccat caccagctac cacaagctga cccccggtca gtgttcggaa        60
     aaggtactgg accagggaca gctgaccatc ggtcggggcc cggacaacga ctgggtcctg       120
     ccggacccgg agcgcctggt ctccagccgc cactgcacca tcctcaaccg cgacggggtg       180
     tactacctca ccgacaccag caccaacggc gtgctgctgg tcaatgccgg gcaccgcctg       240
     cgccgcggca acagcgagcc gctgcaggac ggcgagaccg tccgcctcgg cgaatacgac       300
     atcctcgtcc agctcggcca cgacatcgcc ctgcccggca gcggcaatcc gcagaccgat       360
     ccgttcacca gcttcgacgc actgatgagc cggcaggccg ccggatcggc gcctgccttc       420
     gccgaaccgg cgcccacccc gcaccccgcg gtgacggcgc atttccaggg cggctcgccg       480
     ctggacacca agcccgacct gttcgacttc ctcaccccgc cgccgcccgg cgcggcgccg       540
     cgtccggacc atgtaccggc cgaacagcac gacttccgcc cgccggaacc ggtgatcccg       600
     ctgccccccg cgaccacccc ggcgccaccg cccgctggcg gcgcaccgct gattccggcc       660
     gactgggacc cgttcgccga actgctcggc aacacgcccg cgccaagcgc cacgcccgtc       720
     gtccagccgc agccagcggc cgaaccgacg ccgctggcga tgcccttcgc cgacccgggg       780
     atcacccaac agccacagcc acagccacag ccacagccac agccacagcc acagccacag       840
     ccacagccac agccacagcc agccagcgtg gcggcgccga cgcccccggc aagcgccgcc       900
     gcgacggccg gcggcgacct gctgcaggcg ttcctgcgcg gcgccggcat gacccagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page