(data stored in ACNUC7421 zone)

EMBL: CP000438.PE84

CP000438.PE84        Location/Qualifiers
FT   CDS_pept        97777..98811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00990"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15038"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK28"
FT                   /protein_id="ABJ15038.1"
FT                   /translation="MLDVPVLLAAVSPDSPCGDDLEYDAAFLELERIAQGQPERQMGDA
FT                   VLPAEPPEWPRVRALASELFGRSKDLRVANLLLQSNVALDGLDGLAEGLLLVRELLGQY
FT                   WDGVYPLLDADDDNDPTFRINALTGLVAEPLLQLVWAIPLVRSRAFGPVNLRAALNAAG
FT                   LQRFASETLSPEQIAGAFADADADALAATRRALDGAQEHALAIESGVAERVGSAQGLDL
FT                   GPLRQLLRQALQVFDLYGPQGAGEPLAPGAEAATGEQGGAAPVAAVAAPAPRASGEIAN
FT                   REDVLRQLDRLLEYYVRHEPSSPVPVLLKRAKTLVTADFAEIVRNLIPDGISQFETLRG
FT                   PESE"
     gtgctggatg tacccgtttt gctggccgcc gtatccccgg actcgccctg tggcgacgat        60
     ctggagtacg acgccgcgtt cctcgaactc gaacgcatcg cccagggcca acccgagcgc       120
     cagatgggcg atgccgtgct gcccgccgaa ccgccggagt ggccgcgcgt acgcgcgctg       180
     gccagcgagc tgttcggccg tagcaaggac ctgcgggtag ccaacctgct gctgcagagc       240
     aacgtcgccc tcgacggcct ggacgggctc gccgaaggcc tgctgctggt ccgcgagctg       300
     ctcggccagt actgggacgg cgtctatccg ttgctcgacg ccgatgacga caacgacccc       360
     accttccgta tcaacgccct caccggcctg gtcgccgaac cgctgctgca actggtctgg       420
     gcgatcccgc tggtgcgctc gcgggcgttc ggcccggtca acctgcgcgc cgcgctgaac       480
     gccgccgggc tgcaacgctt cgccagcgag accctgagtc ccgagcagat cgccggcgcc       540
     ttcgccgatg ccgacgccga tgcgctggcc gccacccggc gcgccctgga tggcgcccag       600
     gaacatgccc tggccatcga gagcggcgtc gccgaacggg tcggctcggc ccagggcctc       660
     gacctcggtc cccttcgtca actgctgcgc caggccctcc aggtgttcga cctgtacggc       720
     ccgcagggcg ccggtgagcc cttggcgccg ggcgccgaag cggccaccgg cgagcagggg       780
     ggcgccgcgc ctgtcgcagc cgtcgccgcg ccggcaccgc gtgccagcgg cgagatcgcc       840
     aaccgcgaag acgtcctgcg ccagctcgac cgcctgctcg agtattacgt tcgccacgag       900
     ccgtcgagcc cggtgccggt gctgctcaag cgcgccaaga cactggtgac ggccgacttc       960
     gccgaaatcg tgaggaatct catccccgat gggatttccc agttcgaaac cctgcgaggc      1020
     ccggaaagcg agtaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page