(data stored in ACNUC7421 zone)

EMBL: CP000438.PE85

CP000438.PE85        Location/Qualifiers
FT   CDS_pept        98900..99418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15039"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK88"
FT                   /protein_id="ABJ15039.1"
FT                   /translation="MGSTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMAD
FT                   LAGKPAEPQAAVADRKFLEIDVDNFDARLKAMKPRVAFNVPNVLTGEGNLSLDITFESM
FT                   DDFSPAAVARKVDSLNKLLEARTQLANLLTYMDGKTGAEEMIMKAIKDPALLQALASAP
FT                   KPKDDEPQA"
     atgggaagca ctaccagcag tcagaagttc atcgccagga accgggcgcc acgcgtgcag        60
     atcgagtacg acgtggagct gtacggtgcc gagaagaagg tccagttgcc cttcgtcatg       120
     ggcgtcatgg ccgacctcgc cggcaagccc gccgaacccc aggcggcggt cgccgaccgc       180
     aagttcctgg agatcgacgt ggacaacttc gatgcccggc tgaaggcgat gaagccgcgg       240
     gtggccttca acgtaccgaa cgtgctgacc ggcgaaggca acctgagcct ggacatcacc       300
     ttcgagagca tggacgactt cagccccgcc gcggtggcgc gcaaggtcga ttcgctgaac       360
     aagctgcttg aggcgcgtac ccagctggcc aacctgctga cctacatgga tggcaagacc       420
     ggcgccgagg aaatgatcat gaaggcgatc aaggacccgg ccctgcttca ggccctggcc       480
     agcgcgccga agcccaaaga cgacgagccg caggcgtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page