(data stored in ACNUC7421 zone)

EMBL: CP000438.PE86

CP000438.PE86        Location/Qualifiers
FT   CDS_pept        99431..100927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01020"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15040"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJR5"
FT                   /protein_id="ABJ15040.1"
FT                   /translation="MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAV
FT                   RTLAEHALEQTSLISNDAIKSIESIIAALDAKLTAQVNLIMHHADFQQLESAWRGLHYL
FT                   VNNTETDEQLKIRVLNISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCL
FT                   VGDYYFDQSPPDVELLGEMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTT
FT                   PEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWAN
FT                   SAYAMAVNINRSFKLYGWCSRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDR
FT                   REAELAKNGFMPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCR
FT                   FAHYLKCIVRDKIGSFKEKDEMQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVE
FT                   EVEGNPGYYNSKFFLRPHYQLEGLTVSLRLVSKLPSAKEA"
     atggccgaat tgagcaccga gaacctggcc cagggccaga ccaccaccga gcagaccagc        60
     gagttcgcca gcctgctgct gcaggagttc aagcccaaga ccgagcgcgc ccgcgaagcg       120
     gtggagaccg ccgtgcggac cctcgccgag catgccctgg agcagaccag cctgatctcc       180
     aacgacgcga tcaagtcgat cgagtcgatc atcgcggcgc ttgacgccaa gctcaccgcg       240
     caggtcaacc tgatcatgca ccacgccgac ttccagcaac tggaaagcgc ctggcgcggc       300
     ctgcactacc tggtcaacaa caccgagacc gacgagcaac tgaagatccg tgtgctgaac       360
     atctccaagc cggagctgca caagaccctg aagaaattca agggcaccac ctgggaccag       420
     agcccgatct tcaagaagct ctacgaagag gaatacggcc agttcggcgg cgagccctat       480
     ggctgcctgg tcggcgacta ctacttcgac cagtcgccgc cggacgtcga gctgctcggc       540
     gagatggcga agatctccgc cgccatgcat gcgccgttca tctccgccgc ctcgccgacg       600
     gtgatgggca tgggttcctg gcaggaactg tccaacccgc gcgacctgac caagatcttc       660
     accaccccgg aatacgccgg ttggcgttcg ctgcgcgagt ccgaggactc ccgctacatc       720
     ggcctgacca tgccgcgctt cctggcgcgc ctgccctacg gggcgaagac cgatccggtg       780
     gaagagttcg ccttcgagga agaaaccgac ggcgccgaca gcagcaagta cgcctgggcc       840
     aactcggcct acgcgatggc ggtcaacatc aaccgctcct tcaagctcta cggctggtgc       900
     tcgcggatcc gtggcgtcga gtccggcggc gaggtgcagg gcctgccggc gcacaccttc       960
     cccaccgacg acggcggcgt ggacatgaag tgcccgaccg agatcgccat ttccgaccgc      1020
     cgcgaggcgg agctggcgaa gaacggcttc atgccgctgc tgcacaagaa gaacaccgac      1080
     ttcgccgcct tcatcggcgc gcagtcgctg cagaaacccg ccgagtacga cgatccggac      1140
     gccaccgcca acgccaactt ggcggcgcgc ctgccctacc tgttcgccac ctgccgcttc      1200
     gcccattacc tgaagtgcat cgttcgcgac aagatcggtt ccttcaagga gaaggacgag      1260
     atgcagcgct ggctgcagga ctggatcctc aactacgtcg acggcgaccc ggcccactcc      1320
     accgagacca ccaaggccca gcacccgctg gcggcggccg aagtggtggt ggaggaagtc      1380
     gaaggcaatc cgggttacta caactcgaag ttcttccttc gcccgcacta ccagctcgag      1440
     ggactgacgg tatcgctacg cctggtatcc aagctgcctt cggccaaaga ggcctga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page