(data stored in ACNUC7421 zone)

EMBL: CP000438.PE87

CP000438.PE87        Location/Qualifiers
FT   CDS_pept        101003..101491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01030"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15041"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="PDB:4KSR"
FT                   /db_xref="PDB:4KSS"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ24"
FT                   /protein_id="ABJ15041.1"
FT                   /translation="MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGG
FT                   GGAGKVNVQDLSFTKYIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKE
FT                   VLVSSVSTGGSGGEDRLTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA"
     atggctgttg atatgttcat caagatcggc gacgtcaagg gtgagtccaa ggacaagact        60
     cacgccgagg aaatcgacgt gctggcatgg agctggggca tgtcccagtc cgggtcgatg       120
     cacatgggcg gtggcggcgg cgccggcaag gtcaacgtgc aggacctgtc gttcaccaag       180
     tacatcgaca agtccacgcc caacctgatg atggcctgct ccagcggcaa gcactatccg       240
     caggcgaagc tgaccatccg caaggccggc ggcgagaacc aggtcgagta cctgatcatc       300
     accctgaagg aagtcctggt gtcctcggtg agcaccggcg gcagcggtgg cgaggatcgc       360
     ctgaccgaga acgtgaccct gaacttcgcc caggtccagg tcgactacca gccgcagaag       420
     gcggatggcg cgaaggacgg cggtccggtc aagtacggct ggaacatccg ccagaacgtg       480
     caggcctga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page