(data stored in ACNUC7421 zone)

EMBL: CP000438.PE88

CP000438.PE88        Location/Qualifiers
FT   CDS_pept        101659..102504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01040"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01040"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15042"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK14"
FT                   /protein_id="ABJ15042.1"
FT                   /translation="MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRS
FT                   QPSNATLRIFLFQLLAVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVF
FT                   AGRLTPVILGQPAEWIAPLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAW
FT                   LADADTRLGPVLEVIVNGRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVA
FT                   LLPARYAETVEHGDDAARLGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
FT                   "
     atggccgacc cttcattcgc atccgggcgc ctgggctccc ggctacaggg aagtatcgcg        60
     atgatcgccg aagaactgtt gcgcgccggg cgcctggacg atgccttgaa agccttgcag       120
     gaacaggtgc gcagccagcc gtcgaacgcc accctgcgga tcttcctgtt ccagctgctg       180
     gccgtgatgg gccagtgggc gcgggcgcag aaccagctca aggtggtcgg cgaactggat       240
     gcctcggcgc tgccgatggt acagacctac tccaccgcca tcgactgcga ggcgctgcgc       300
     cgcgaggtgt tcgccgggcg cctgacgccg gtgatcctcg gccagccggc ggaatggatc       360
     gcgccgctgt tgcaggccct gagcctggac gccgagggcc atggcgaggc cgcccaggcc       420
     ctgcgcgagc aggccttcga cgccgcgccg gcggtgcccg ggcggatcgg cgaagcgccg       480
     ttcgcctggc tggcagatgc cgacacgcgc ctcggcccgg tgctcgaggt aatcgtcaac       540
     ggtcgctatg cctggttgcc gatgagcaac ctgcgcagcc tcaaggtcga ggcgccgagc       600
     gacctgcgcg acctggtctg gctgccggcc gaactgaccc tggccaacgg tggcgccacc       660
     gtcgcgctgc tgccggcgcg ctacgcggaa accgtcgagc acggcgacga cgccgcgcgc       720
     ctggggcgca agaccgaatg gctggatagc ggcctgccgg tcggccagcg gctgttcgtc       780
     accgatgccg gcgagaccgc gctgttcgac ctgcgtgagc tggacttcga gccgacggac       840
     gcctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page