(data stored in ACNUC7421 zone)

EMBL: CP000438.PE89

CP000438.PE89        Location/Qualifiers
FT   CDS_pept        102506..103015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15043"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK32"
FT                   /protein_id="ABJ15043.1"
FT                   /translation="MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLSQLKASVL
FT                   RDLAWLFNTTSLFDHGPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATF
FT                   EPRIIRSSLRVRAQLLPGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQ
FT                   GERRRT"
     atggctgaac tgaccctcca ggagcgcctg cagccgtcgc tgctcgaccg cctcaccgac        60
     gacgagccgg gcaacctcaa ggaagccgcg gagcgccggg tgctgaccct gagccagctg       120
     aaggcctcgg tgctgcgcga cctggcgtgg ctgttcaaca ccacttcgct gttcgaccac       180
     ggccccgccg cacggatgcc ggccggcaac tcggtgctca actacgggct gccggcgctg       240
     gccgggcaca ccgcgtcgag cgtcgacgtg catgccatcg aggcgctgct caccgagacc       300
     atcgccacct tcgagccgcg catcatccgt tcttcgttgc gggtgcgcgc gcaactgctg       360
     cccggcgaga tggaccacaa cgccctgagc ttcgagatcg agggcgatct ctgggccgaa       420
     ccggcgccgc tgcgcctgct gctgaccacc aacctggacc tggagaccgg tcacgtgcgc       480
     gtcgcccagg gcgagcggag gcgtacatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page