(data stored in ACNUC7421 zone)

EMBL: CP000438.PE90

CP000438.PE90        Location/Qualifiers
FT   CDS_pept        103012..104871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15044"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK96"
FT                   /protein_id="ABJ15044.1"
FT                   /translation="MNPRLLEYYNQELQHIRESAAEFAEEFPKIAGRLSLSGFECADPY
FT                   VERLLEGFAYLTARVQLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLRPDPNEGAL
FT                   SSGFSVERGASLRGQLGPDDQTACEYRTAHPVTLWPLEVAQADYFGNPAAVLGRLAASE
FT                   PRAKAGLRIRLRSGAGIPFDSLSLDALPLYLHGADEQPYRLYEQLLGNACAVFVRAPDN
FT                   AWVERLPTSSLRARGFDDEDALLPVVPRAFQGYRLLQEYFALPARFLFVEFSGLNRALR
FT                   RCHGEELELVVLFGKHDQRLEGTVDAEQLVPFCTPAINLFPRRCDRIHLSDRVNEHHVI
FT                   VDRTRPLDFEVHSLQQVSGHGSGPEQPFQPFYAVRDPARYGREQAYFSVRREPRVLSSK
FT                   QRRKGPRSTYVGSETFVALVDANQAPYRHDLRQLGIAALCTNRDLPLFMPIGAHKSDFT
FT                   LEDSAPVMQVRCLAGPSRPRASRAHDASAWRLISQLSLNYLSLAERGQGAAALRELLRL
FT                   YGDSGDPALQLQIEGLREVSSKPCTRRLPMPGPIVFGRGLEITLDFDENAFRGTGVFLL
FT                   GAVFERFLARYVSINSFTETVLRTGERGEVMRWQAKPGSRPNL"
     atgaacccgc gcctgctcga gtactacaac caggaattgc aacacatccg cgaaagcgcc        60
     gcggagttcg ccgaggagtt cccgaagatc gccgggcgcc tgtcgctgtc cggcttcgag       120
     tgcgccgacc cctacgtcga gcgcctgctg gaaggcttcg cctatctcac cgcgcgggtc       180
     cagctgaagc tcgacgcgga gtacccgacc ttcacccaca acctgctgga aatcgcctac       240
     ccgcactacc tggcgccgac tccgtcgatg accgtggtgc agctgcgccc ggaccccaac       300
     gaaggcgccc tgagcagcgg cttcagcgtc gagcgcgggg cctccctgcg cggccagctc       360
     ggccccgatg accagaccgc ctgcgaatac cgcaccgccc acccggtgac cctgtggccg       420
     ctggaagtgg cccaggccga ctacttcggc aatcccgccg cggtgctcgg ccgcctcgcc       480
     gccagcgagc cgcgggccaa ggccggcctg cgcatccgcc tgcgcagcgg cgccggtatc       540
     ccgttcgaca gcctgtcgct ggacgccctg ccgctctacc tgcacggcgc cgacgaacaa       600
     ccctaccgcc tctacgaaca attgctcggc aacgcctgcg cggtgttcgt ccgcgccccg       660
     gacaatgcct gggtcgaacg cctgccgacg agcagcctgc gtgcgcgtgg cttcgacgac       720
     gaggacgcgc tgctgccggt ggtgccgcgg gcgttccagg gctaccgcct gctgcaggaa       780
     tacttcgccc tgccggcgcg cttcctgttc gtcgagttct ccggcctgaa ccgcgccctg       840
     cgtcgatgcc acggcgagga gctggaactg gtcgtgctgt tcggcaagca cgaccagcgc       900
     ctggagggca cggtggacgc ggagcaactg gtgccgttct gcaccccggc gatcaacctg       960
     ttcccgcgcc gctgcgaccg catccacctg tccgaccggg tcaacgagca tcatgtgatc      1020
     gtcgaccgca cccgtccgct ggatttcgag gtgcattcgc tgcaacaggt gagcggccac      1080
     ggcagcggtc cggagcaacc cttccaaccg ttctacgcgg tgcgcgaccc ggcgcgctac      1140
     ggccgcgagc aggcctactt cagcgtgcgc cgcgaaccgc gcgtgctgtc cagcaagcag      1200
     cggcgcaagg gcccgcgctc gacctacgtc ggcagcgaga ccttcgtcgc cctggtcgac      1260
     gccaaccagg cgccctatcg ccacgacctg cgccagctcg gcatcgccgc gctgtgcacc      1320
     aaccgcgacc tgccgctgtt catgccgatc ggcgcgcaca agagcgactt caccctggag      1380
     gacagcgccc cggtcatgca ggtgcgctgc ctcgccggac cgagccggcc gcgcgccagc      1440
     cgtgcccacg atgccagcgc ctggcggctg atcagccagc tgtcgctgaa ctacctgtcg      1500
     ttggccgagc gcggccaggg cgccgccgcc ctgcgcgagc tgctgcggct ctacggcgac      1560
     agcggcgatc cggcgctgca actgcagatc gagggcctgc gcgaggtcag cagcaagcct      1620
     tgcacgcggc gcctgccgat gcccgggccg atcgtcttcg gccgtggcct ggagatcacc      1680
     ctggacttcg acgagaacgc gttccgtggc accggggtgt tcctcctcgg cgccgtgttc      1740
     gagcgcttcc tggcacgcta cgtgtcgatc aacagcttta ccgagacggt gctgcgcacc      1800
     ggcgaacggg gcgaggtgat gagatggcag gcgaagccgg gcagccgtcc gaacctctga      1860
//

If you have problems or comments...

PBIL Back to PBIL home page