(data stored in ACNUC7421 zone)

EMBL: CP000438.PE91

CP000438.PE91        Location/Qualifiers
FT   CDS_pept        104835..105881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15045"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS0"
FT                   /protein_id="ABJ15045.1"
FT                   /translation="MAGEAGQPSEPLNLLAGMAAAPWDYDFFQALRRIECESPQLPRLG
FT                   HSVRLADDPLRLGQKPDCTFAPSTLASVSQAGTAAVPRLDQFFFGLTGPNGPLPLHLTE
FT                   YARERQRNVNDATFKRFMDVFHHRLLTLFYRAWAEARPEISHDRIDDDYWSARLAALSG
FT                   RGMPSLRGREPLADTARYYYTGHLAAQTRYPDGLRVILAEYFEVPVAVEEYVGQWLELP
FT                   ERSRLGVDSTSLGMDVCLGTHVWDRQHKFRLRLGPLDLDQYQRFLPDGDHFVELAAWVA
FT                   EYLGEELDWDVNLVLQRHEVPPLGLQGGGRLGFNTWLGDPGQDARDLLLARQYATARPH
FT                   EHKEKEHE"
     atggcaggcg aagccgggca gccgtccgaa cctctgaacc tgctcgccgg gatggcggcg        60
     gcgccctggg attacgactt cttccaggcg ctgcggcgca tcgagtgcga gtcgccgcaa       120
     ctgccgcgcc ttggtcattc ggtgcggctg gcggacgacc cgctgcgtct cgggcagaag       180
     cccgactgca ccttcgcgcc ctcgaccctg gcctcggtga gccaggccgg caccgctgcg       240
     gtgccgcgcc tggaccagtt cttcttcggc ctcaccggcc ccaacgggcc gctgccgctg       300
     cacctcaccg aatacgcccg agaacgccag cgcaacgtca acgacgcgac cttcaagcgc       360
     ttcatggacg tcttccacca ccgcctgctg accctgttct accgggcctg ggccgaggcg       420
     cggccggaga tcagccacga ccggatcgac gacgactact ggtcggcgcg tctcgccgcg       480
     ctctccgggc gcggcatgcc gagcctgcgg gggcgcgagc cgctggcgga caccgcacgc       540
     tactactaca ccggccacct cgccgcgcag acccgctacc cggacggcct gcgggtgatc       600
     ctcgcggagt atttcgaggt cccggtggcg gtcgaggaat acgtcggcca atggctggag       660
     ctgcccgagc gcagccgcct cggcgtcgac tcgacgagcc tgggcatgga cgtctgcctg       720
     ggcacccacg tctgggaccg ccagcacaag ttccgcctgc gcctggggcc gctggacctc       780
     gatcaatacc agcgcttcct gcccgacggc gaccacttcg tcgagctggc cgcctgggtc       840
     gccgaatacc tgggcgagga gctggactgg gacgtcaacc tggtcttgca acgccacgaa       900
     gtacccccgc tgggcctgca gggcggcggg cggctcggtt tcaacacctg gctgggcgat       960
     cccggccagg acgccaggga tctactgctg gcccgccagt acgccactgc gcggccgcac      1020
     gagcacaagg agaaggaaca tgagtga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page