(data stored in ACNUC7421 zone)

EMBL: CP000438.PE94

CP000438.PE94        Location/Qualifiers
FT   CDS_pept        complement(110675..110959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01120"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15048"
FT                   /db_xref="InterPro:IPR040818"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK35"
FT                   /protein_id="ABJ15048.1"
FT                   /translation="MSPVNYVERALALVAERLARHPQCGMLLSVEKQLLYLKAVLLDRS
FT                   LDRSALHRLSFGGIAGKEFEETDPELARALKDAFYVGIRTGRGLKVDLP"
     atgtcccccg tgaactatgt cgaacgcgcc ctggcgctgg tcgccgagcg gctggcccgg        60
     catccgcaat gcgggatgct gctctccgtg gaaaagcagt tgctgtacct gaaagccgtg       120
     ctgctcgacc gcagcctgga ccgttccgcg ttgcaccggc tgagcttcgg cggcatcgcc       180
     gggaaagagt tcgaggagac cgacccggaa ctcgccaggg ccctcaagga cgcattctac       240
     gtcggcatac gcactggccg cggcctgaag gtcgacctac cctga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page